KEGG   Photorhabdus asymbiotica: PAU_01417Help
Entry
PAU_01417         CDS       T00941                                 

Gene name
fadJ
Definition
fatty acid oxidation complex subunit alpha (EC:1.1.1.35)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
pay  Photorhabdus asymbiotica
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAU_01417 (fadJ)
   01212 Fatty acid metabolism
    PAU_01417 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PAU_01417 (fadJ)
   00650 Butanoate metabolism
    PAU_01417 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    PAU_01417 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    PAU_01417 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PAU_01417 (fadJ)
   00310 Lysine degradation
    PAU_01417 (fadJ)
   00380 Tryptophan metabolism
    PAU_01417 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PAU_01417 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PAU_01417 (fadJ)
   00281 Geraniol degradation
    PAU_01417 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    PAU_01417 (fadJ)
Enzymes [BR:pay01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PAU_01417 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PAU_01417 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PAU_01417 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1608636..1610819
Genome map
AA seq 727 aa AA seqDB search
MTQFQNDTVAVTTDTKQAASVFNFDVRPDKIGVITIDVPGEKVNTLKAEFVDQFLHVFKQ
AQQVSGLKGLILISGKPDNFIAGADISMIAGCKTKEEAQDLAEKGQKLFSQIANYPLPVV
AAIHGACLGGGLELALACHWRICSLDDKTRLGLPEVQLGLLPGSGGTQRLPRLIGVSSAL
DMILTGKQLRARQALRLGVVDDAVPLDILLEIAVEKVKKGIPMRKSLPWQQRLLVGPVGR
YFLFNIVRKKTLAKTRGHYPATERIIDVVKEGLEKGMNQGLRAEAMAFGELAMTRESAAL
RNLFFAATSLKNETGSSEKPAKIERVGILGGGLMGGGIANVTATRGKLPARIKDINEKGI
SQALKYSWDLLSKRVKQKRLRPVERDQQMMLISGTTDYSGFEQVDIVVEAVFEDLSLKQQ
MVAEIEANTKPETVFASNTSSLPIHQIAEKAQRPEQVIGLHYFSPVDKMPLVEVIPHKDT
SEKTIATAVALAKKQGKTAIVVGDKAGFYVNRILVPYISEASNCLVAGEPIDRIDKALVN
FGFPIGPINLLDEVGIDVGTKIMPILVEQLGQRFAAPESLNVVLKDGRKGRKNGRGFYLY
TSESGKFWRMGKKGKKVDSSIYTLMNIKPESRMLSSEIAQRCVMLMLNEAVRCLDEGIIR
SPRDGDIGAVFGIGFPPFFGGPFRYIDSLGCARVVEILRRLESQYGDRFVPCERLVKMAE
QNKNFYP
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgactcagtttcagaatgatactgtagccgttactacagatacaaaacaggctgcttct
gttttcaattttgatgtcaggccggataaaatcggtgttatcacgattgatgtgccagga
gaaaaagtaaatacgctgaaagcagaatttgttgatcaatttctgcatgttttcaaacaa
gctcagcaggtttctggccttaaaggattaatattgatttccggtaaaccggacaatttt
attgccggtgctgatatttcgatgattgctggatgtaaaaccaaagaagaagcacaagat
ctggctgaaaaggggcaaaagttattttctcagatagccaattatcctttgcctgttgta
gcggcaattcatggtgcttgtttgggaggtggtttggaattagcgctggcatgtcattgg
cgtatatgttcactggatgataaaacccgtcttggattacctgaggttcagcttggatta
ttacctggttcaggtggtactcagcgattgccgagacttattggtgttagttcagcgttg
gatatgatcctgacaggtaagcaattaagagcaagacaggcattgcggctgggagtcgtg
gatgatgctgtgccattggatattttgctggaaattgctgttgaaaaagtcaaaaaaggc
attcctatgcgtaagtctttaccgtggcaacagcggttattggtagggcctgtcggaaga
tactttttgtttaatatcgttcgtaaaaaaacactggcgaaaactcgtgggcattatcct
gcaactgaacgaattattgacgttgtcaaagaaggtcttgaaaaaggcatgaatcaaggt
ttacgggccgaggcaatggcatttggtgaactagcaatgacacgggaatctgccgcttta
cgcaatctattttttgccgcaacgtcattgaaaaatgagactggttcatcagagaaacca
gcaaaaattgaacgtgttggcatattaggtggtggtttgatgggtgggggaattgcgaat
gtaacagctacccggggcaaattaccagcgcgtattaaagatattaatgaaaagggtatt
agccaggcattaaagtactcttgggatttactgtccaagcgcgtgaaacaaaaacgatta
cgtccggtagaacgagatcagcaaatgatgcttatttcaggaacgacggattatagtggt
ttcgaacaggtagatattgttgttgaggcggtatttgaagatttatcactgaaacaacaa
atggtggcagaaattgaagcgaataccaaaccggaaacggtatttgcatctaatacatct
tcgcttcctatccatcagattgctgaaaaagctcaacgaccagagcaggttattggtctg
cattatttcagcccggtagataaaatgcctctggtggaagttattccacataaagacacc
agtgagaaaacgattgctacagcagttgctttggctaagaagcagggtaaaaccgctatt
gtggtaggtgataaagccggattttatgtaaaccgtatccttgttccttatatcagtgag
gcatcaaattgcctggtagcaggagagccaattgatcgtatagataaggctctggttaat
tttggttttccaatagggccaattaatttattggatgaagtaggaattgatgttggcacc
aaaattatgcctattttggtagagcaattagggcaacgttttgcggctcctgaatctctt
aatgttgtactgaaagatggtcgcaaaggtaggaaaaacggtcgtggtttctatttatat
acatcagaatccggaaaattttggcggatgggtaagaaaggtaaaaaagttgatagttca
atttataccttgatgaatataaagcctgaatctcgtatgctttcttcagaaattgctcag
cgttgtgtgatgttgatgcttaatgaagccgttcgttgtttggatgaagggattatcaga
agtccgcgtgatggtgatattggtgcggtatttggtataggttttccaccattctttggt
ggccccttccgctatattgatagccttggttgtgccagggtggtggaaattctacgtagg
ttggaaagtcagtatggagatagattcgtaccttgtgagcgtttggtgaaaatggctgaa
cagaataaaaatttctatccatag

  All links  
No link information was found.   
DBGET integrated database retrieval system