KEGG   Photorhabdus asymbiotica: PAU_01716Help
Entry
PAU_01716         CDS       T00941                                 

Gene name
nagZ
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pay  Photorhabdus asymbiotica
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PAU_01716 (nagZ)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    PAU_01716 (nagZ)
Enzymes [BR:pay01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PAU_01716 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1937913..1938935
Genome map
AA seq 340 aa AA seqDB search
MGPVMLDVVSYELDSEEKEILQHPLVGGLILFTRNFHDVEQLRELVRQIRKASRHRLVIA
VDQEGGRVQRFREGFTRLPAAQSFAGLGDNFNGMKLAEEAGWLMASEMIAMDIDISFAPV
LDLGHQCVAIGERSFHENPEQAMIMAEHFIKGMHSAGMKSTGKHFPGHGAVCADSHKETP
HDDRPLELICRHDMSIFRDFIQRNLLDAIMPAHVIYSQVDKYPASGSSYWLKSVLRQQLG
FNGVIFSDDLSMEGAAIMGDYAERGQAALHAGCDMILVCNNRDGAVSVIDNLPQTRVEKV
SELYHQGGQFSLNELKDSKRWQQANKVLTALHDKWQNCER
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggggccggtaatgttagatgttgtcagttatgaactagatagtgaagaaaaggaaatt
ttacaacatccattagtgggtggtttaattctgtttacccgcaattttcatgatgttgag
caattacgtgaattagtacgtcagattcgtaaggcttcccgtcatcgtcttgtgattgct
gttgatcaggaaggtggcagagtgcagcgtttccgtgaaggtttcactcgtttaccggcg
gcccagtcttttgctggattgggtgataactttaatggcatgaaattggcagaagaagcg
ggttggctcatggcatccgaaatgattgccatggatatcgacatcagttttgcccctgtt
ctggacttaggtcatcaatgtgtggctattggtgaacgttcattccatgaaaaccctgaa
caggccatgattatggctgagcactttattaaaggtatgcattcggctggcatgaaatcg
acgggtaaacactttccgggacatggtgctgtctgtgccgattctcataaagaaacgcct
cacgatgatcgtcctctggaactcatttgtcgtcatgacatgtctattttccgtgatttt
atccagcgtaatttgttggatgcgattatgccggctcatgtgatttattctcaggtagat
aaatatcccgctagtggatcatcatattggttgaaatcagtgctgcgtcagcaattaggc
tttaatggcgtgatattttcagatgatctttctatggagggggcggcaattatgggagat
tatgctgagcgtgggcaggctgcattgcatgcaggctgtgacatgatcttggtgtgtaat
aaccgtgatggggcggtcagtgtgattgataacttgcctcagaccagggtagagaaagta
tcagaattgtatcatcagggaggtcaattcagtttgaatgagctaaaggattcaaaacgc
tggcagcaggctaataaagtattaactgcgttacatgataaatggcagaattgtgagcgg
taa

DBGET integrated database retrieval system