KEGG   Photorhabdus asymbiotica: PAU_02025Help
Entry
PAU_02025         CDS       T00941                                 

Gene name
galU
Definition
utp--glucose-1-phosphate uridylyltransferase (udp-glucos pyrophosphorylase) (udpgp) (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pay  Photorhabdus asymbiotica
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PAU_02025 (galU)
   00052 Galactose metabolism
    PAU_02025 (galU)
   00500 Starch and sucrose metabolism
    PAU_02025 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    PAU_02025 (galU)
Enzymes [BR:pay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PAU_02025 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
<2269334..2270248
Genome map
AA seq 304 aa AA seqDB search
VNKIVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIILVTHS
SKNSIENHFDTSFELEAILEKRVKRQLLDEVQSICPSHVTIMQTRQGIAKGLGHAVLCAK
PLIGDEPFAVILPDVILDEYSTDLTKYNLSEMLARYNETGISQILVEPVPHEEVSSYGIV
DCLGESLQPGDSKPIKRVVEKPKPEEAPSNLSIVGRYVLSERIWPLLAKTAPGAGDEIQL
TDAIAMLMEEESVEAYHLQGLSHDCGNKLGYMQAFVRYGMKHYELGSEFTDWLGRVALQN
QTKE
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtaaacaaaatagttaaaaaagccgttattcccgtcgcgggattaggaaccaggatgtta
ccggctacgaaagcgattcctaaagagatgctacctttagtggataagcctcttattcag
tatgttgtgaatgaatgtattgccgctggcattaatgaaattatcttggttactcattca
tcgaaaaattcaattgagaaccattttgataccagttttgagctagaagcaatccttgaa
aaaagggtgaaacgtcagttattggatgaagttcagtctatttgtccaagccatgtcacc
attatgcaaacccggcagggaattgctaaagggttagggcatgcagtgttatgtgcaaag
cctttaattggtgatgagccttttgctgtgatactccctgacgttattcttgacgagtac
agtactgacctaactaaatataatctgagtgagatgttggctcgttataatgaaactggg
atcagccagatattagtagagcctgtgcctcatgaagaagtttccagttatggtattgtc
gattgcttgggagaaagtctgcaacctggtgatagtaaacccattaaacgtgtagttgaa
aaacctaaaccggaagaagcaccatcaaacctttctattgttggccgttatgtgttgtct
gaaagaatttggccgttattggcaaaaacagcaccaggggctggtgatgaaattcaactt
accgatgcaattgctatgttaatggaagaggaatccgtagaagcataccacttgcagggt
ttaagccatgattgtggcaataagcttggctatatgcaggcgtttgtccggtatggcatg
aaacattatgagttaggttcagagtttactgattggttagggcgagtggctttacagaat
cagactaaagaataa

DBGET integrated database retrieval system