KEGG   Photorhabdus asymbiotica: PAU_02030Help
Entry
PAU_02030         CDS       T00941                                 

Gene name
adhE
Definition
(GenBank) aldehyde-alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00010  Glycolysis / Gluconeogenesis
pay00071  Fatty acid degradation
pay00350  Tyrosine metabolism
pay00620  Pyruvate metabolism
pay00625  Chloroalkane and chloroalkene degradation
pay00626  Naphthalene degradation
pay00650  Butanoate metabolism
pay01100  Metabolic pathways
pay01110  Biosynthesis of secondary metabolites
pay01120  Microbial metabolism in diverse environments
pay01130  Biosynthesis of antibiotics
pay01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAU_02030 (adhE)
   00620 Pyruvate metabolism
    PAU_02030 (adhE)
   00650 Butanoate metabolism
    PAU_02030 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    PAU_02030 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    PAU_02030 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PAU_02030 (adhE)
   00626 Naphthalene degradation
    PAU_02030 (adhE)
Enzymes [BR:pay01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PAU_02030 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     PAU_02030 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 HTH_AsnC-type Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: CAQ84122
UniProt: C7BII4
Position
complement(2274724..2277384)
Genome map
AA seq 886 aa AA seqDB search
MAVTNATELNEMVARVKKAQREFANFSQEQVDKIFRAAALAAADARIPLAKLAVAESGMG
IVEDKVIKNHFASEYIYNAYKDDKTCGILAEDKTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKKATNKAAELVLRAAIEAGAPEDIIGWIDEPSVELSNA
LMHHQDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDESADIKRAVASILMSKTF
DNGVICASEQSVIVVDSVYEQVRERFFTHGSYLLQGKELKAVQDIILKDGNLNAAIVGQP
ATKIAKMAGLNVPEKTKILIGEVSQIDETEPFAHEKLSPLLAMYRGNSFEDAVEKAEKLV
EMGGIGHTSCLYTDQDNQAARIKYFGDKMKTARILVNTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINTKTVAKRAENMLWHKLPKSIYFRRGSLPIALGEVATDGAK
RAFIVTDRFLFNNGYADQVTDVLKSHGIETEVFFEVEADPTLSIVRKGAEQMHSFKPDII
VALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGIKAKMIAITTTSG
TGSEVTPFAVVTDDTTGQKYPLADYALTPDMAIVDANLVMDLPKSLCAFGGLDAITHSLE
AYVSVLANEYSDGQALQALKLLKEFLPASYHEGATNPIARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSATGDRTATKIEKLLAWLEELKSGLDIPTSIRAAGIQEADFLAKIDKLSEDAFDDQ
CTGANPRYPLISELKQLLLDSYYGREFTETIATPEETKPTINPDKN
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaatgctactgaactgaatgaaatggttgcccgagttaaaaaagcgcaa
cgtgaatttgctaatttctctcaggaacaagttgacaaaatcttccgagctgccgctctt
gcagcagccgatgcgcgtattcctttagcaaaattagccgtggcagaatccggtatgggg
attgtcgaagacaaagtaattaaaaatcactttgcttccgaatacatctacaacgcatat
aaagatgataaaacttgtggcattttggctgaagataaaacattcggcactatcactatt
gctgaacctataggtttaatctgcggcatcgtgccaaccactaacccaacatctacggct
atttttaaagctctaatcagtctgaaaactcgtaacggtattattttctcaccgcaccca
cgagctaaaaaagcaaccaacaaagccgctgaattggttctacgtgctgcgatcgaggcc
ggtgccccagaagatattattggctggattgatgaaccctctgttgaactttccaatgca
ctgatgcaccaccaagatattaacctcattctggctaccggcggcccgggtatggtaaaa
gcggcatatagctctggtaagcccgcaatcggcgttggcgcgggtaacacccccgttgta
attgatgaatccgcggatattaaacgggctgttgcatctattctaatgtccaaaactttc
gacaacggcgttatttgcgcttcagagcaatctgttatcgtagtggattctgtctatgaa
caggtgcgtgaacgattctttactcacggcagttatctgttacaaggcaaagagctgaaa
gctgttcaggatattatcctgaaagacggtaacctgaacgcagcaattgttggtcagccc
gcaactaaaattgccaaaatggcaggtctcaatgttcctgaaaaaaccaagatcctgatt
ggggaagtcagccagattgatgaaactgaaccttttgctcacgaaaaactttctccactg
ctcgctatgtatcgtggtaacagctttgaagatgcagtagaaaaagcagaaaaactggtt
gaaatgggtggtattggtcacacttcctgcctgtataccgatcaagataatcaagcagca
agaatcaagtattttggcgacaaaatgaaaacagctcgtatcctggtgaatacacccgca
tcacaaggtggtatcggtgatctttacaacttcaaacttgctccatctctgacactcggt
tgtggttcctggggtggaaactccatctccgaaaacgtgggaccaaaacatctcatcaac
accaaaaccgtggcgaagagagcagaaaatatgttatggcataaacttccaaaatcaatt
tacttccgtcgtggttccctgcctatcgcacttggggaagtcgcaaccgatggtgcaaaa
cgggcctttatcgtaacagaccgtttcttattcaataatggctatgctgatcaagtcact
gacgtgctgaaatcccacgggatagaaacagaagttttctttgaagttgaagccgacccg
acattgagcatcgttcgtaaaggtgcagaacaaatgcactcatttaaaccggatatcatt
gtcgcactaggggggggttctccaatggatgccgccaaaattatgtgggtaatgtatgaa
caccctgaaacacacttcgaagaattagctctacggtttatggatatccgtaagcgcatc
tacaaattcccgaaaatgggcatcaaagctaaaatgatagcaattaccacaacttctggc
accggatctgaagtgacaccatttgccgttgtcaccgatgatacaaccggtcaaaaatat
ccattggctgactatgcactgactccagatatggctatcgttgatgctaatctagtcatg
gatttaccaaaatcactgtgtgcttttggtggcctggatgcaatcacccattctctggaa
gcttatgtatctgtgctggcaaacgaatactctgacggacaagctctccaagcactgaaa
ctactaaaagaattcctcccagccagctatcacgaaggtgcaactaaccctattgctcgt
gaacgggttcataatgctgcaaccattgctggcattgcatttgctaacgcctttctggga
gtatgtcactctatggcgcataagctgggttctgagttccatattccacacggccttgct
aacgcactactgatttgtaacgttatccgttataacgctaacgataacccaactaaacag
actgcattcagccaatatgaccgcccacaggcccgtcgtcgctatgctgaaattgcagat
catcttggcttatctgctaccggggaccgtactgcaacaaaaattgaaaaactgctagca
tggctagaagaactgaaatctggactggatatcccaacctctatccgcgctgccggtatt
caagaagcagactttttggcgaaaatcgataagttgtctgaagatgcttttgacgaccaa
tgcaccggcgctaaccctcgctatcctctgatttctgagctgaaacaattattgctagat
tcatactatggccgcgaattcacagaaacaattgcaacaccggaagagactaaaccaaca
ataaatcctgataaaaactaa

DBGET integrated database retrieval system