KEGG   Photorhabdus asymbiotica: PAU_02050Help
Entry
PAU_02050         CDS       T00941                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pay  Photorhabdus asymbiotica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PAU_02050 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAU_02050 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PAU_02050 (trpA)
Enzymes [BR:pay01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PAU_02050 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2296869..2297675)
Genome map
AA seq 268 aa AA seqDB search
MERYKQLFKKLENLKQGAFIPFVTLGDPNPELSLKIIDTLIASGADALELGIPFSDPLAD
GPTIQNANLRAFSSNVTPTLCFELLSKIRAKYPDIPIGLLMYANLVFHNGIDAFYQRCKD
ADIDSVLVADVPISESRPFRTAAIKHGIAPILICPPNAEDELLREIASHSRGYTYLLSRP
GVTGTERRAEQPLNHLVNKLREYHAAPPLQGFGISEPEQVKEALANGAAGVISGSAIVKI
IEEYLSQPEIMQKKLTEFVSKMKSATQV
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttacaagcaactatttaaaaagctggaaaaccttaaacaaggtgcttttatc
ccctttgtcacactaggcgatccaaatccggaattatcgctgaaaattattgatacactc
attgcaagtggcgctgatgcacttgaattggggattcctttttctgatccgctggctgat
ggcccgacaattcaaaatgccaatctacgtgctttttcctcaaatgtcaccccaaccctt
tgttttgaactactctccaagattcgagcgaaataccctgatattccaattggtttatta
atgtacgcaaatctggtttttcataatgggatagatgcgttttatcaacgctgcaaagat
gcagatatcgactctgtattagttgcagatgttcctatatcagaatcacggccattccgt
accgcagcgataaaacatggaatcgcacctattcttatttgcccacccaatgcagaagat
gaattattacgtgaaatcgcttcccatagcagaggatatacctatctattatccaggcct
ggggttaccggtacagaaagacgcgccgaacagcctttaaatcatttggtcaataagttg
agagaatatcacgctgcccccccattacaaggatttggtatttcagagcctgagcaggta
aaagaagcactagcaaacggagcggctggagtcatttctggatctgcaatagtcaaaatt
attgaagaatatctttctcagccagaaataatgcagaaaaaactgactgaatttgtctca
aaaatgaaatctgcaactcaagtttag

DBGET integrated database retrieval system