KEGG   Photorhabdus asymbiotica: PAU_02262Help
Entry
PAU_02262         CDS       T00941                                 

Gene name
wbmC
Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pay  Photorhabdus asymbiotica
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PAU_02262 (wbmC)
Enzymes [BR:pay01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PAU_02262 (wbmC)
Peptidases [BR:pay01002]
 Cysteine Peptidases
  Family C44
   PAU_02262 (wbmC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2557570..2559507
Genome map
AA seq 645 aa AA seqDB search
MGNFNMKLWSVVINATTIDIDAYVNALFNAMTDIQIDSMKKMDHQWATMIEADVRLCDTE
RKLTGIEISTAHSSYSGWIRDLDNDLLISSFRQNAPILDPSQGRVIGEFSYISIQPGHVH
AVTDHYATHPVYYWQGKNRQWVISNDLRMLLLFHHVPLNIRHESCFEFLTQSVMVGENEL
ADGATFFAEIRKMPINSVLKINRTDGIFKLAPMNTSAASQYSKTLSYHENFQHAFRECFD
TCVADRLKAGADGILLSGGIDSSTVLGASLALNESPPMFCANMSFRDADLAMSQDDKIVE
ALVHHCNLPHNIVYADDFLRLPAPDDPIAYVDGPEPSANPLAKEALASVFQHNNVSLIMT
GEGGDIILGESMHQWILDSIRIHDGIGELHKYITENLRVRPFSLDYFRHILTSLSPYLGR
RALIKEVSNDQRLPDYFGAVLHNSMSQQAKLQKIKIACSQAKYLGHDYIKTLLFPRATYF
DSLNIYCTHSHPLLDPRMTAFMLSCPPHLNHDYKRLNLANPYATSKMLARKAYSDILPNF
ATDKQSKTSYALMARRMFYNSAKEMLRLTDRPMILDSWKFIDQAQFRRYLMAYIIATEDP
NTQLGVEYHYLRGVIDLEAWLMKFTQERTSVIHYLKFSPLRTFVN
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacttcaatatgaaactttggtcggtggtaataaacgctacgacgattgatata
gatgcatatgttaacgctctcttcaatgccatgacagatatccaaatcgatagcatgaag
aagatggatcaccaatgggcaacaatgatcgaagccgatgttcgcctttgcgatactgaa
cgaaagttgactggcattgagatatctactgctcattcatcttacagcggatggatacgt
gatttggacaacgatcttcttatttcatcattccgccaaaacgcgccgatacttgatcca
tctcagggaagagtaataggtgagtttagctacatatcgattcagcccggccatgtgcat
gctgtgaccgatcactatgcgacacatccggtttattactggcagggaaagaatagacag
tgggtcattagtaatgacttaagaatgttactgttgtttcatcatgtgccgctcaacata
agacatgagtcatgctttgaattcctaacgcagtccgtcatggtaggagaaaacgaactg
gccgatggcgcaactttctttgctgaaatacgaaagatgccgataaacagcgtattgaag
atcaatagaacagatgggatatttaaattggcaccaatgaacacaagcgcagcttctcag
tacagcaagacgctctcttatcatgagaactttcagcacgcattccgagaatgctttgat
acgtgtgtggcagaccgcctcaaagccggcgcagatgggattctactaagcggaggaata
gactcaagtactgtcctcggcgcaagcctcgcattgaatgaaagccctcccatgttctgc
gccaatatgagcttcagagatgcagaccttgcaatgagtcaagatgataaaattgttgag
gcactagttcatcactgcaaccttcctcacaatattgtctatgccgatgattttcttcgt
ttgccggcaccagatgatccaatcgcctacgtcgacgggccagagccatccgctaaccca
cttgccaaggaggctttagctagcgtttttcagcacaacaatgtatcgcttattatgacg
ggagaaggcggagatatcattcttggagaatcgatgcatcaatggattctagattcgatt
cgtatacacgacggaatcggggagttacataaatatatcaccgagaatctgcgggtgcgt
cctttttctctggactactttcgccatatactcacttctctttcaccttatttgggaaga
cgggcattgattaaggaggtgtcaaatgaccagaggctgcccgactactttggggctgtg
ctgcataattctatgagccaacaagctaaattacaaaaaataaagatagcgtgctctcag
gctaaatatcttggccatgattacattaaaactttactttttcctcgagccacttatttc
gattcgctgaacatttactgcacacattctcatcctcttctagatccgaggatgaccgca
tttatgctgtcctgtccaccgcatctaaaccatgattacaaacgtctcaatcttgccaac
ccatatgcaacttcaaagatgctggcgagaaaggcttattccgacatactacccaatttt
gctaccgacaaacagagcaaaacaagttatgcattaatggctcgtcgtatgttttataac
agcgcgaaagagatgttgcgtttgacggataggccaatgatcttggatagttggaagttc
attgatcaggcccaattccgtcgctatttgatggcctatatcattgcgacggaagatccc
aacactcagcttggtgttgaataccattacctacgtggagtgatagatcttgaagcctgg
ctgatgaaatttacgcaggagcgaacttctgtaattcactacctgaaattttcacccttg
cgtactttcgtgaactaa

DBGET integrated database retrieval system