KEGG   Photorhabdus asymbiotica: PAU_02528Help
Entry
PAU_02528         CDS       T00941                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pay  Photorhabdus asymbiotica
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PAU_02528 (ispE)
Enzymes [BR:pay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PAU_02528 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2885978..2886853
Genome map
AA seq 291 aa AA seqDB search
MTLTWPSPAKLNLFLYITGRRADGYHQLQTLFQFLDYSDDITITPRQDNEIRLLTPVDGV
EPANNLIVRAARLLQSYSHQQNTGIVHKGADIHINKRLPMGGGLGGGSSNAATVLIALNY
HWQTGFTDETLATLGVSLGADVPIFIKGHAAFAEGIGEILQLAEPEEKWYLVAHPGIEIS
TLRVFTDPELKRDTPIRSLAALLKAPYTNDCEPLVRKRFREVEQLLSWLLEYAPSRLTGT
GACIFGEFESEASARKVLNKAPEWLHGFVARGVNNSPLHNFRSGIPVLLNQ
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgactctgacctggccctcaccggcaaaacttaacctgtttctctatatcactggtcgc
cgcgctgatggttatcatcaattgcaaacgctatttcagtttcttgattacagcgatgac
attacgattaccccacgtcaagataatgaaattcgtttactgacaccagtagacggtgtg
gaacccgctaacaacctgattgttcgtgcagcgcgtttattgcaatcctacagccatcaa
caaaatacgggaattgttcacaaaggtgcggatatccatatcaacaagcgcttacctatg
ggcggtggattaggtggcggttcatctaatgctgctacagtgttaattgcactgaattat
cactggcaaacgggcttcacagacgaaacactggcaacccttggcgtgagtcttggtgct
gacgtacccatctttatcaaaggtcacgcggcatttgcagaaggtattggtgaaatcctg
caactagcagaaccggaagaaaaatggtatctggtggctcaccctggtattgaaatctca
actctgcgcgtcttcacagatccagaattaaaacgtgatacaccaattcgctctctggcc
gcattattaaaggctccgtacacaaatgattgtgaacctcttgtaagaaaacgttttcgt
gaggttgaacagcttctttcatggctgctagaatacgcgccgtcacgcctaaccggaacc
ggtgcatgtatattcggtgaattcgaatcagaagcatcggcccgtaaggtgttaaataaa
gcccctgagtggttgcatggttttgttgcgcgtggcgtaaacaattcacctttgcataat
tttcgctctgggatacccgtgttattgaaccaatga

DBGET integrated database retrieval system