KEGG   Photorhabdus asymbiotica: PAU_02874Help
Entry
PAU_02874         CDS       T00941                                 

Gene name
hisCD
Definition
putative histidine biosynthesis bifunctional protein (EC:1.1.1.23 2.6.1.9)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pay  Photorhabdus asymbiotica
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PAU_02874 (hisCD)
  Amino acid metabolism
   00340 Histidine metabolism
    PAU_02874 (hisCD)
Enzymes [BR:pay01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PAU_02874 (hisCD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3323152..3324468
Genome map
AA seq 438 aa AA seqDB search
MITRFKTPIRWQEYNGKQQQALLTRPAVVASEEISHTVEQILDAVKERGDDTLRELSLHF
DKTVIENIRISPEEIAAADNRLNNDIKQAMQQAMHNIRTFHEAQKPVKIEVETQPGVYCQ
QVTRPIDSVGLYIPGGSAPLPSTVLMLGTPAKIAGCRKIVLCSPPPIADEILYAAKLCGI
TEIFQIGGAQAIAAMAFGTESVPKIDKVFGPGNAYVTEAKSQISQRIDGAAIDMPAGPSE
VLIIADKDANPVFAAADLLSQAEHGPDSQVILITPDEKLAKAVIKEIEKQLSQLPRNLIA
VKALEHSRIIVTESLQQCVEISNFYGPEHLIIQTRQPEQLVEKITNAGSVFLGDWSPESA
GDYASGTNHVLPTYGYTSTYSSLGLADFLKRMTIQQLTPKGLLNLSQTIETLAQAEQLTA
HKNAVTLRVAALNIADKE
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgattactcgtttcaagaccccaattcgttggcaggaatataatggtaaacaacaacaa
gctttactgacacgccctgctgttgttgcttctgaagaaatttcccacacagtggaacag
attctagacgcggtaaaagaacgtggcgatgacaccctgcgagaacttagtctacatttc
gacaaaaccgttattgaaaacatccgtatttcaccagaagaaatagcagccgctgataac
cgcctcaataacgatattaaacaagcgatgcagcaagcaatgcataatatccgcactttc
catgaagctcagaaaccggtaaaaattgaagtagaaactcagccaggagtttattgccag
caagtaacacggcctatcgattctgtcgggttgtatattcccggaggttcagcaccatta
ccgtctacagttttaatgctcggaacgcctgccaaaatagcaggttgccgcaaaattgtg
ctttgttctccgccccctattgcagatgaaattctctatgctgccaaattatgcggaatt
acagaaatattccagattggcggtgcccaggccattgcagctatggcgttcggaacagaa
tccgtacctaaaatagataaagttttcggccctggtaatgcttatgttactgaagctaaa
agccaaattagtcaacgaatagatggtgctgctattgatatgccagcaggcccgtcagaa
gtgcttattattgccgataaggatgcaaatccagtatttgctgccgccgatttactttca
caagcagaacatggcccagattcacaagtcatattgataacgcctgatgaaaaattagcc
aaagcagttataaaggaaatcgaaaaacaactatcccagctcccccgtaatctgatagcg
gttaaggcattagaacatagccggattatcgtgacagaaagcctgcaacaatgtgtggaa
atcagtaacttctatggccctgagcacctgattattcagactcgtcagccagaacaactg
gttgaaaaaatcaccaatgcggggtctgttttcctcggtgactggtcgccagaatctgcg
ggagattacgcttcaggaaccaaccacgtcttgccaacctatggctacacctcaacttat
tctagccttggtctggctgatttcctgaaacgtatgactattcagcaactgactccgaaa
gggctattaaatctatctcagaccatcgaaacactggcacaggcagaacaactcaccgct
cacaaaaacgcagtgactttacgtgtagctgctctgaatattgcagacaaggagtga

DBGET integrated database retrieval system