KEGG   Photorhabdus asymbiotica: PAU_02899Help
Entry
PAU_02899         CDS       T00941                                 

Gene name
folE
Definition
FolE subunit of GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pay  Photorhabdus asymbiotica
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pay00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3352121..3352789)
Genome map
AA seq 222 aa AA seqDB search
MEKIMSSLSKEAELVHSALEARGLETPLRGQTLAPEVRKVRIEEHMTEIMKLLNLDLSDD
SLADTPGRIAKMYVDEIFSGLDYSNFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTI
DGKATVAYIPKDKVIGLSKINRIVQFFSQRPQVQERLTQQILIALQTLLGTNNVAVSIDA
VHYCVKARGIRDATSTTTTTSLGGLFKSSQNTRQEFLRTTRH
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
ttggagaaaataatgtcatctctaagtaaagaagctgagcttgtgcattcagcgctggaa
gctcgtggccttgagactcctttacgtggtcagacactggcaccggaagtacgcaaagta
cgcattgaagagcatatgacggaaattatgaaactgttgaatcttgacctgagtgatgac
agtttggcggatacccccggtcgtattgcgaaaatgtatgttgacgaaattttttcaggg
ttggattacagcaatttcccgaaaatcaccttaatagaaaacaaaatgaaagtggatgaa
atggtgaccgtacgtgatatcacgttaaccagcacctgcgaacaccattttgtgactatt
gatggtaaagctactgttgcctatatcccaaaagataaagtcattgggttatctaagatt
aaccgtatcgtgcagtttttttcacagcgtccgcaggtacaagaacgcttgacacaacag
atcctgattgcattacagacgctgcttggtaccaataatgtcgcagtatctattgatgcg
gtccattattgtgtgaaggctcgaggcatccgtgatgcaaccagtaccacgacaacgaca
tctctgggagggttgtttaaatccagtcagaatacccgtcaggagtttttacgcacgact
cgccattag

DBGET integrated database retrieval system