KEGG   Photorhabdus asymbiotica: PAU_03122Help
Entry
PAU_03122         CDS       T00941                                 

Gene name
gene0068
Definition
putative phage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
pay  Photorhabdus asymbiotica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3690488..3690913)
Genome map
AA seq 141 aa AA seqDB search
MQISEKGLAKLKGYEGCSLTSYRCPAGVWTIGYGHTLGVKPGDAITEQQAEQFLLDDLAP
VYITIEHNVKVKLTQGQFDALCSFIFNCGAGAFVRSTLLKKLNAGDYNGAANEFMRWNMA
GGRILPGLDARRASEKTMFLS
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcagtgagaaagggttagcgaaactcaaaggctatgagggttgtagcttaact
tcataccgttgtcccgcaggggtatggacaatcggctatggtcatactttgggcgtcaag
cccggcgatgcaatcacagagcaacaagcagagcagttcttgcttgatgacttagcgccg
gtttacatcacaattgagcataacgttaaagtaaaactgacgcagggccagtttgatgca
ctgtgttcatttatcttcaactgtggtgccggtgctttcgtccgttctactttgcttaag
aaactcaatgctggtgactacaacggcgcagccaatgagtttatgagatggaatatggct
ggtgggagaatattaccggggctggatgctcgcagggcatcggaaaaaacgatgttttta
tcatga

DBGET integrated database retrieval system