KEGG   Photorhabdus asymbiotica: PAU_03330Help
Entry
PAU_03330         CDS       T00941                                 

Definition
(GenBank) Phage related lysozyme
  KO
K01185  lysozyme [EC:3.2.1.17]
Organism
pay  Photorhabdus asymbiotica
Brite
Enzymes [BR:pay01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     PAU_03330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_lysozyme
Motif
Other DBs
NCBI-ProteinID: CAQ85418
UniProt: B6VNM2
Position
complement(3908480..3908983)
Genome map
AA seq 167 aa AA seqDB search
MAVINLTLCVFVHSVKITCLTEERMKLSEKGFELIKHFEGLRLHAYQCSANVWTIGYGHT
AGVRLGDVISAEKADAFLRRDVADAERTVNNAVSVSINQHQFDALVSFVFNLGAGNFRSS
VLLKKLNAGDYAGAAGELLRWVNAGGQKLAGLVRRREAEKMLFETPV
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtgattaacctgacgctgtgtgtttttgttcacagcgtaaagataacctgttta
acggaggagagaatgaagctgagtgaaaaagggtttgaactgataaaacattttgaaggt
cttcgccttcatgcctatcagtgttcagcaaacgtctggactattggttacggacatact
gctggagtacgtcttggagatgttatcagcgctgaaaaggcagatgcttttttacgtcga
gatgtggctgatgctgaacgcacggtaaacaatgcggtcagtgtttcgattaaccagcat
cagttcgatgcactggtgtcatttgttttcaatctgggggcagggaatttccgctcttca
gtgttgctgaaaaaattgaacgctggagattatgccggcgcggcaggtgaattgttgcgc
tgggtgaatgctggtgggcaaaaactggctggtttggtgcgtcggcgggaagccgaaaaa
atgttgtttgaaacaccagtgtaa

DBGET integrated database retrieval system