KEGG   Photorhabdus asymbiotica: PAU_03330Help
Entry
PAU_03330         CDS       T00941                                 

Definition
Phage related lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
pay  Photorhabdus asymbiotica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3908480..3908983)
Genome map
AA seq 167 aa AA seqDB search
MAVINLTLCVFVHSVKITCLTEERMKLSEKGFELIKHFEGLRLHAYQCSANVWTIGYGHT
AGVRLGDVISAEKADAFLRRDVADAERTVNNAVSVSINQHQFDALVSFVFNLGAGNFRSS
VLLKKLNAGDYAGAAGELLRWVNAGGQKLAGLVRRREAEKMLFETPV
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtgattaacctgacgctgtgtgtttttgttcacagcgtaaagataacctgttta
acggaggagagaatgaagctgagtgaaaaagggtttgaactgataaaacattttgaaggt
cttcgccttcatgcctatcagtgttcagcaaacgtctggactattggttacggacatact
gctggagtacgtcttggagatgttatcagcgctgaaaaggcagatgcttttttacgtcga
gatgtggctgatgctgaacgcacggtaaacaatgcggtcagtgtttcgattaaccagcat
cagttcgatgcactggtgtcatttgttttcaatctgggggcagggaatttccgctcttca
gtgttgctgaaaaaattgaacgctggagattatgccggcgcggcaggtgaattgttgcgc
tgggtgaatgctggtgggcaaaaactggctggtttggtgcgtcggcgggaagccgaaaaa
atgttgtttgaaacaccagtgtaa

DBGET integrated database retrieval system