KEGG   Photorhabdus asymbiotica: PAU_03581Help
Entry
PAU_03581         CDS       T00941                                 

Gene name
gene0097
Definition
phage lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
pay  Photorhabdus asymbiotica
Brite
Enzymes [BR:pay01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     PAU_03581 (gene0097)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4186687..4187112
Genome map
AA seq 141 aa AA seqDB search
MQISEKGLAKLKGYEGCSLTSYRCPAGVWTIGYGHTLGVKPGDAITEQQAEQFLLDDLAP
VYITIEHNVKVKLTQGQFDALCSFIFNCGAGAFVRSTLLKKLNAGDYNGAANEFMRWNMA
GGRILPGLDARRASEKTMFLS
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcagtgagaaagggttagcgaaactcaaaggctatgagggttgtagcttaact
tcataccgttgtcccgcaggggtatggacaatcggctatggtcatactttgggcgtcaag
cccggcgatgcaatcacagagcaacaagcagagcagttcttgcttgatgacttagcgccg
gtttacatcacaattgagcataacgttaaagtaaaactgacgcagggccagtttgatgca
ctgtgttcatttatcttcaactgtggtgccggtgctttcgtccgttctactttgcttaag
aaactcaatgctggtgactacaacggcgcagccaatgagtttatgagatggaatatggct
ggtgggagaatattaccggggctggatgctcgcagggcatcggaaaaaacgatgttttta
tcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system