KEGG   Photorhabdus asymbiotica: PAU_03772Help
Entry
PAU_03772         CDS       T00941                                 

Gene name
yqeF
Definition
(GenBank) probable acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pay  Photorhabdus asymbiotica
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PAU_03772 (yqeF)
   00630 Glyoxylate and dicarboxylate metabolism
    PAU_03772 (yqeF)
   00640 Propanoate metabolism
    PAU_03772 (yqeF)
   00650 Butanoate metabolism
    PAU_03772 (yqeF)
  Lipid metabolism
   00071 Fatty acid degradation
    PAU_03772 (yqeF)
   00072 Synthesis and degradation of ketone bodies
    PAU_03772 (yqeF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PAU_03772 (yqeF)
   00310 Lysine degradation
    PAU_03772 (yqeF)
   00380 Tryptophan metabolism
    PAU_03772 (yqeF)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PAU_03772 (yqeF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PAU_03772 (yqeF)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PAU_03772 (yqeF)
Enzymes [BR:pay01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PAU_03772 (yqeF)
Exosome [BR:pay04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PAU_03772 (yqeF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4373048..4374226
Genome map
AA seq 392 aa AA seqDB search
MRDVVVVAAKRTATGSFQGSLAAQPATFLGSTVIQALLAESGVAALDIEQVIMGQVLTAG
CGQNPARQAALRAGLPVTIQAMTINKVCGSGLKAVHLGMQAIQSGEAEIVIAGGQENMSL
APHILPMSRQGIRLGHSELKDSLVHDGLWDAFHHFHMGVTAENVAKQFNITRAQQDEYAL
LSHHRAVHAQQAGYFNDEIVAVEIAGRKGEILRFVQDEGPRETSIEKLSSLKPVFQKEGT
VTAGNASSLNDGAAAVLLCSREKAESLNLQPLATLSGFANTGIEPELMGAAPIEAIHQCI
LKQQWKPEDVDVLESNEAFAAQALAVLSSCGIPSERVNPYGGAIALGHAIGASGCRILVT
LIHNLKRNRLQNGIAALCIGGGEGVALAVTRS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagagacgttgttgttgttgctgctaaacgtacggcaacaggcagtttccagggttcg
ctagctgctcaacctgcaacttttcttggcagtacggtcatccaagccttgctagcagaa
agcggtgttgctgcactagatattgaacaggtcattatgggacaagtgctgacggccggt
tgtggacaaaatccagcgcggcaagctgcattgcgagcggggttaccagttactatccaa
gctatgaccattaataaggtctgtggttcaggtctgaaagctgttcatttgggtatgcaa
gcgatccaaagtggtgaagcggagatagttattgctggtgggcaggaaaacatgtctctg
gctcctcacattctacccatgtctcgacaagggattcgtctcggccacagtgaactgaaa
gatagtttggtacatgatggcctttgggatgcttttcatcattttcacatgggagtaaca
gcagaaaatgtcgcaaagcaatttaatataacacgtgctcaacaggatgaatacgcgctt
ctatcacatcaccgggctgttcatgctcaacaggcgggatatttcaatgacgagattgtt
gctgttgagatagccggaagaaagggagaaattctccgtttcgtacaagatgaggggcca
cgggagactagcatagaaaaattatcttctctgaagcctgtctttcagaaagaagggacc
gtgacagccggtaatgcatcttccctgaatgatggcgctgcagcagtgttattatgtagc
cgcgagaaagcagaaagtctaaatttacagccattggctactttgagcggctttgccaat
acaggtattgagcccgagcttatgggagcggctcccattgaagcgatacaccagtgtata
ttaaaacagcagtggaagcctgaggatgttgatgtacttgaatcaaacgaggcatttgct
gcacaggctttggctgtgctttcttcgtgtggtattccatctgagcgtgtcaatccttat
ggtggtgctattgctttaggacatgccatcggtgcttctggatgtcgcattcttgtgacg
ttaatccataacttgaaacggaaccgtttgcagaatggtatcgctgcgctgtgtattggc
ggtggtgaaggagtggctttggcggtcactcgttcataa

DBGET integrated database retrieval system