KEGG   Photorhabdus asymbiotica: PAU_03878Help
Entry
PAU_03878         CDS       T00941                                 

Gene name
hemB
Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pay  Photorhabdus asymbiotica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PAU_03878 (hemB)
Enzymes [BR:pay01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PAU_03878 (hemB)
Exosome [BR:pay04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PAU_03878 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4523067..4524080)
Genome map
AA seq 337 aa AA seqDB search
MSYAFPGTFPGRRMRRVRRHDFSRRLVAENQLTVNDLIYPVFVMEGTNCRQEVPSMPGVY
RLTIDLLLKEAEEIARLGIPVLSLFPVIEADKKSLDAKEAYSPDGLIQRTIRTLKEAVPE
LGLLTDVALDPFTTHGQDGIIDQDGYVINDVTKDILVKQALSHAEAGAEIIAPSDMMDGR
IGAIREKLEEEGHVNTQIMAYSAKYASGYYGPFRDAIGSSSHLKGGNKKNYQMDPANSDE
ALQEIAQDLQEGADTVMVKPGMPYLDVIRRVKETFGVPTFAYQVSGEYAMHMAAIQNGWL
PEQVIMESLLCFKRAGADGVLTYFAKQVAQQLIEQRL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagctatgcatttccaggcactttccctggtcgccgtatgcgtcgagtgcgccgccat
gatttttcccgtcgtttagttgctgagaatcaattaactgtcaatgacttaatctatcct
gtgtttgtgatggaagggactaactgtcgtcaggaagttccttctatgccaggggtgtat
cgtctgacaattgatcttttgttgaaagaagctgaagagattgcccggttggggattcct
gtattgtctctgtttcctgttattgaagcagataaaaaatctctggatgcgaaagaagct
tatagtcctgatggactaattcaacggactatacgcacgctgaaagaagcggttcctgaa
ctgggattattgactgatgtagcattagatccgttcactacacatggtcaggatggaatt
attgatcaggatggttatgtaattaatgatgttaccaaagatatcttggtcaaacaggcg
ctgtcacatgcggaggctggtgctgagattattgcgccaagtgacatgatggacggacgg
attggtgcaattcgagagaagcttgaagaggaaggtcatgtaaatactcagattatggct
tattccgctaagtatgcttctggttattatggtcctttccgtgatgctatcggttcaagt
agtcatctaaaaggtggtaataaaaagaattatcaaatggaccctgctaacagcgatgaa
gcgttgcaagagattgctcaggatttgcaggaaggcgctgatactgtgatggttaaaccg
ggtatgccttacctggatgttatccgtagggtaaaagagacatttggtgtcccaaccttt
gcttaccaagtatctggtgaatatgccatgcatatggctgctatccagaatgggtggtta
ccggaacaggtaattatggaatccctgttgtgtttcaagcgtgcgggagcagatggcgtg
ctgacatattttgcaaaacaggttgctcaacagttaattgagcagcggttgtaa

DBGET integrated database retrieval system