KEGG   Photorhabdus asymbiotica: PAU_04060Help
Entry
PAU_04060         CDS       T00941                                 

Gene name
cysQ
Definition
protein cysq
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pay  Photorhabdus asymbiotica
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pay00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4724937..4725680)
Genome map
AA seq 247 aa AA seqDB search
MLEQICQLAREAGAAIMAIYQDEHPLKVEHKQDDSPVTVADIVAHKIIKTGLSRIAPEIP
LLSEEEPPAWEDRRDWKRYWLVDPLDGTKEFINRNGEFTVNIALIDAGVPVMGVVYAPVQ
DTLYSGQGRQAWKKTCGGQWLPIKIRDANPPMVVVSRSHMDTELEDYLNQLGEHQTVSVG
SSLKFCLVAEGKAQLYPRFGPTHVWDTAAGHAVAIAAGAHVTNWKGQTLDYTPRESFLNP
GFRVTIF
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgctagaacaaatctgccaattggcccgggaagctggcgcagctattatggcaatttac
caggatgaacatcctttgaaagttgagcataagcaggatgattcaccggttactgttgct
gatattgtggctcataaaataattaaaactggattatctcgtatcgcaccagaaattcca
ctgttgtcggaagaagaacctccagcttgggaagataggcgtgattggaagcgttattgg
ttagttgatcctctggatgggactaaggaattcattaatcgtaacggtgagtttacggtt
aatattgccttgattgatgcgggagtccctgtaatgggtgtggtatatgctcctgtgcag
gatacgctttattcagggcaggggcgacaggcatggaaaaaaacctgtggtgggcagtgg
ttgccgattaaaattcgtgatgccaatcccccgatggtggtcgttagccgctctcatatg
gatacagaattagaagattatctcaatcagttaggtgagcaccagactgtctctgttggt
tcttcattgaaattctgcttagtggctgaaggaaaggcgcaactttatcctcgttttgga
ccaactcatgtctgggataccgctgcgggtcacgctgtagcaattgctgctggcgctcat
gtgacaaactggaaaggtcaaactctggattatacgcctcgtgaatcatttttgaatccg
ggattcagagtaacaattttttag

DBGET integrated database retrieval system