KEGG   Photorhabdus asymbiotica: PAU_04126Help
Entry
PAU_04126         CDS       T00941                                 

Gene name
hemD
Definition
uroporphyrinogen-iii synthase (uros) (uroporphyrinogen-ii cosynthetase) (hydroxymethylbilane hydrolyase [cyclizing])
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pay  Photorhabdus asymbiotica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PAU_04126 (hemD)
Enzymes [BR:pay01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PAU_04126 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4791140..4791880
Genome map
AA seq 246 aa AA seqDB search
MSILVTRPSPAGEELVRRLQTAGKTAFSAPLIDIRPGSELSQLAEKLCCLNTGDMVFLLS
KNAVYYANSQLKKINLSWPNKLIYYAIGRSTALAFHQLTGINITWSSEGETSETLLELPS
LHQVKNKQALLLRGNGGRELIAQTLTERGATVNYCECYFRQRVDYSAAEFSARWQRYGVQ
TLVVTSGEILQLLYNLVPKSDRNRWLLNCHLIVVSERLAYTARNLGWQDVKVAKSADNDA
LIQALE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtattctggtgacacgcccttctcctgccggagaagaattagtcagaaggttacag
accgcgggcaaaactgctttcagcgcgcctttaatcgatattcgcccaggttcagaacta
tcacaactggccgaaaaactttgctgcttgaataccggtgatatggtattcctgttgtca
aaaaatgcagtttattacgcaaactcacagttaaaaaagattaatctatcatggccgaac
aagctgatttattatgctattggtagatcaactgctctggcttttcatcaactgactggt
ataaatattacctggtcatcagagggcgaaaccagcgaaactctactagaactcccctcc
ttacatcaggttaaaaataaacaagctttgctactcagaggaaatggtgggcgtgaactt
attgcccaaactttgacagaaaggggtgccacagttaattattgtgaatgttattttcgc
cagcgagtagattactcggcagcagaattcagcgcccgctggcagagatatggagtacag
actttagttgtaaccagcggcgaaatactgcaactgttatataacttagtacccaaaagt
gatcgaaacaggtggctattgaattgccatcttattgtggtaagtgaacgtcttgcatac
accgcccggaatctgggttggcaagatgtcaaagttgctaaaagtgcagataacgatgcc
ttaattcaggcactagaataa

DBGET integrated database retrieval system