KEGG   Photorhabdus asymbiotica: PAU_04262Help
Entry
PAU_04262         CDS       T00941                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00010  Glycolysis / Gluconeogenesis
pay00051  Fructose and mannose metabolism
pay00562  Inositol phosphate metabolism
pay01100  Metabolic pathways
pay01110  Biosynthesis of secondary metabolites
pay01120  Microbial metabolism in diverse environments
pay01130  Biosynthesis of antibiotics
pay01200  Carbon metabolism
pay01230  Biosynthesis of amino acids
Module
pay_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pay_M00002  Glycolysis, core module involving three-carbon compounds
pay_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAU_04262 (tpiA)
   00051 Fructose and mannose metabolism
    PAU_04262 (tpiA)
   00562 Inositol phosphate metabolism
    PAU_04262 (tpiA)
Enzymes [BR:pay01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PAU_04262 (tpiA)
Exosome [BR:pay04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PAU_04262 (tpiA)
  Exosomal proteins of bladder cancer cells
   PAU_04262 (tpiA)
  Exosomal proteins of melanoma cells
   PAU_04262 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM TMP-TENI
Motif
Other DBs
NCBI-ProteinID: CAQ86349
UniProt: B6VLV0
Position
4931585..4932352
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNKLITDLRKELYNVAGCEVAIAPPALYLSQAKQAQVGSHIA
LGAQDVDVNLSGAFTGETSAEMLKDIGAEYIIIGHSERRTYHKESDEFIAKKFAVLKQQG
LIPVLCIGETEQENEAGLTEVVCARQIDAVLNLLGVEAFQDAVIAYEPVWAIGTGKSATP
AQAQTVHKFIRDHIAEKDAAIAEQVIIQYGGSVNANNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAATAKKV
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcggcatccactagttatgggcaactggaaattaaacggcagtacccacatggttaac
aaactcatcactgacctgcgtaaagaattgtacaatgtcgctggctgtgaagtcgctatt
gcaccaccagcactttatctttctcaggctaaacaagcacaagtaggcagtcacatcgct
ctgggcgcacaagacgtcgacgtaaacttgtctggcgcatttactggtgaaacttctgcc
gaaatgctgaaagacattggcgcagaatacattatcatcggccactccgagcgccgtact
taccacaaagaaagtgacgaattcattgcgaaaaaatttgctgttcttaaacaacaaggt
ctgatcccagtactgtgcatcggtgaaacggaacaggaaaacgaagccggtctgactgaa
gttgtatgtgcaaggcaaattgatgctgtgctgaacttactgggagtggaagcatttcaa
gatgcagtaatcgcttacgaacctgtctgggcaatcggtaccggtaaatcagcaacacca
gcacaagctcaaactgtgcacaaatttattcgtgatcatattgcggagaaagacgcggca
atcgccgaacaagtcattatccagtacggcggttctgtgaatgcaaataacgcggctgaa
ctattcgctcagccagacattgatggtgctctggttggtggtgcttccctgaaagccgac
gctttcgctgttatcgtaaaagccgcggcaacagcgaaaaaagtataa

DBGET integrated database retrieval system