KEGG   Photorhabdus asymbiotica: PAU_04262Help
Entry
PAU_04262         CDS       T00941                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pay  Photorhabdus asymbiotica
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAU_04262 (tpiA)
   01230 Biosynthesis of amino acids
    PAU_04262 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAU_04262 (tpiA)
   00051 Fructose and mannose metabolism
    PAU_04262 (tpiA)
   00562 Inositol phosphate metabolism
    PAU_04262 (tpiA)
Enzymes [BR:pay01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PAU_04262 (tpiA)
Exosome [BR:pay04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PAU_04262 (tpiA)
  Exosomal proteins of bladder cancer cells
   PAU_04262 (tpiA)
  Exosomal proteins of melanoma cells
   PAU_04262 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4931585..4932352
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNKLITDLRKELYNVAGCEVAIAPPALYLSQAKQAQVGSHIA
LGAQDVDVNLSGAFTGETSAEMLKDIGAEYIIIGHSERRTYHKESDEFIAKKFAVLKQQG
LIPVLCIGETEQENEAGLTEVVCARQIDAVLNLLGVEAFQDAVIAYEPVWAIGTGKSATP
AQAQTVHKFIRDHIAEKDAAIAEQVIIQYGGSVNANNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAATAKKV
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcggcatccactagttatgggcaactggaaattaaacggcagtacccacatggttaac
aaactcatcactgacctgcgtaaagaattgtacaatgtcgctggctgtgaagtcgctatt
gcaccaccagcactttatctttctcaggctaaacaagcacaagtaggcagtcacatcgct
ctgggcgcacaagacgtcgacgtaaacttgtctggcgcatttactggtgaaacttctgcc
gaaatgctgaaagacattggcgcagaatacattatcatcggccactccgagcgccgtact
taccacaaagaaagtgacgaattcattgcgaaaaaatttgctgttcttaaacaacaaggt
ctgatcccagtactgtgcatcggtgaaacggaacaggaaaacgaagccggtctgactgaa
gttgtatgtgcaaggcaaattgatgctgtgctgaacttactgggagtggaagcatttcaa
gatgcagtaatcgcttacgaacctgtctgggcaatcggtaccggtaaatcagcaacacca
gcacaagctcaaactgtgcacaaatttattcgtgatcatattgcggagaaagacgcggca
atcgccgaacaagtcattatccagtacggcggttctgtgaatgcaaataacgcggctgaa
ctattcgctcagccagacattgatggtgctctggttggtggtgcttccctgaaagccgac
gctttcgctgttatcgtaaaagccgcggcaacagcgaaaaaagtataa

DBGET integrated database retrieval system