KEGG   Photorhabdus asymbiotica: PAU_04336Help
Entry
PAU_04336         CDS       T00941                                 

Gene name
wbfR
Definition
(GenBank) asparagine synthase, glutamine-hydrolyzing
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00250  Alanine, aspartate and glutamate metabolism
pay01100  Metabolic pathways
pay01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PAU_04336 (wbfR)
Enzymes [BR:pay01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PAU_04336 (wbfR)
Peptidases [BR:pay01002]
 Cysteine Peptidases
  Family C44
   PAU_04336 (wbfR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC NAD_synthase DUF3700 DUF561
Motif
Other DBs
NCBI-ProteinID: CAQ86423
UniProt: C7BSC5
Position
4994503..4996434
Genome map
AA seq 643 aa AA seqDB search
MCGFAGFYCPKGLHSDPSAVLQKMGDAISHRGPDDNGIWFNINTGIAFSHRRLAIIDLTK
TGHQPMHSPSKRFTISFNGEIYNHLNLRRDLKNITWKGNSDTETLLCAIEHWGLEKTLQR
STGMFSFALWDNTTHTLTLARDRIGEKPLYYGWQGNSLLFGSDLISFKHHPEFIPEINRQ
ILTGYLKKGYIEAPNSIFENIFKLTPGTFKTFSNYTPKEGVENVYWSKEKVILSSIENPF
IGTHSEAVEQLESLLSKAISQQMLADVPLGAFLSGGVDSSTIVSLMQSHSKRPIQTFTIG
FNEENYNEAEYAKAVAEHLGTNHTELYVTAQDILNIVPNISKIYSEPFADSSQIPMFLVA
KMAKQHVTVALSGDAGDELFYGYSRYNNTLSAWNKINSLPMSLRKIGKNFINYISPNLIN
KLGLVLTSGKKVYLGDKIHKGAELLEISNFEYFYKNYLLSHYNSTDKLVLNASTDDKNSL
VSSFDSLNNQEKMMAIDSYSYLPDDILVKVDRAAMGTSLETRVPMLDHHVVEFAYSLPIS
YKERDNSSKWPLRQILYKYVPPSLIERPKKGFNIPVRDWLRGPLYEWANDLLDENRIKQE
GFFDPIQIQNLWKEHTDGIRNWSNVLWAILMFQQWYQDYNTSN
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggatttgcaggattttattgcccaaagggattacattcagatccatcggctgtt
cttcaaaagatgggagatgcaatatctcaccgtggtcctgatgataatggtatatggttt
aatataaatactggtattgcgttttctcatcgtcgattagctataattgatctaaccaaa
acagggcaccagcccatgcattctccttccaaacgttttactatttcttttaatggtgaa
atatacaatcaccttaatcttagaagagatttaaaaaatataacctggaaaggaaattct
gatactgaaactttactttgcgccattgagcattggggattagaaaaaacattacaaaga
tctactggtatgttttcctttgctctctgggataatactacacatacactaactttggca
cgtgaccgaattggagaaaaacctctttactatggttggcaaggcaactcacttttattt
ggttcagatctgatatcatttaaacatcatcctgaatttatacctgaaataaacaggcaa
attctaactggttatctaaagaaaggttatattgaagctcctaatagcattttcgaaaac
atctttaagcttactccaggtacatttaaaactttctccaattatactccaaaagaagga
gtagaaaatgtttactggtcgaaagaaaaggttattttgagtagtattgaaaatcctttt
ataggcacccattctgaagcagttgaacaattagaatctttattatccaaggctatctca
caacaaatgttggctgatgttccattaggtgcatttctttccggtggtgttgactcttct
actatcgtttctctgatgcagagtcattcaaaacgccccatacaaacgtttacaattgga
tttaatgaggaaaactataatgaagctgaatatgcaaaggcagtagcagaacacttaggc
actaatcataccgaattatatgtcaccgcacaggatatattaaatatagtaccaaatatc
tcaaaaatatactctgaaccatttgccgattctagccaaattcctatgttcttagttgcg
aaaatggcaaaacagcatgtcactgtagcattatctggtgatgccggtgatgaacttttc
tatggatatagccgatataataatacactcagcgcatggaacaagattaattctcttcct
atgtctttacgtaagatagggaaaaacttcattaattatatttcaccaaatttaattaat
aaactgggtttagtgcttacatctggcaaaaaagtataccttggcgataaaatacataaa
ggagctgagttattagaaataagtaatttcgaatatttttataagaattacttactatct
cattataacagcactgataagttagtattgaatgcgtctaccgatgacaaaaactccttg
gtatccagctttgactcgttaaataatcaagagaaaatgatggcaatagactcatattct
tatttaccagatgatattttagtcaaagttgatcgtgccgcgatgggaacctctttggaa
actagagtcccaatgcttgatcatcatgttgttgaatttgcttactcgttaccaatttcc
tataaagaaagagacaattccagtaaatggccattgagacaaattctatataagtatgtt
ccaccctccctcattgaacgccctaaaaagggctttaacattccagtccgtgactggctt
agaggaccattatatgaatgggcaaatgaccttttagatgaaaatagaataaaacaagaa
ggtttctttgaccctattcaaattcagaatctttggaaagaacatactgacggaattagg
aattggagtaatgttctttgggcaatactaatgttccaacaatggtatcaagattacaac
acttctaattga

DBGET integrated database retrieval system