KEGG   Cutibacterium acnes TypeIA2 P.acn33: TIA2EST2_01300Help
Entry
TIA2EST2_01300    CDS       T01656                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
paz  Cutibacterium acnes TypeIA2 P.acn33
Pathway
paz00790  Folate biosynthesis
paz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TIA2EST2_01300
Enzymes [BR:paz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     TIA2EST2_01300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind Usp Aldolase
Motif
Other DBs
NCBI-ProteinID: AEW78369
Position
312012..312857
Genome map
AA seq 281 aa AA seqDB search
MINVGSATNSHPARTLVMGVVNVTPNSFSDGGMWADPEVAIRHARDLVVEGADIIDVGGE
STRPGTERTPEHEELRRVLPVVKALVADGVAVSVDTMRASVAKAVVEAGATIVNDVSGGK
AEPEILDVVADAGVDYVLMHWRGQSATMQNLVDYDDVVADVISETSQQVDAAIAAGIDRR
RIIVDPGIGFSKTSEHNWQLMNAVDAFQEGFADLRVLWGVSRKRFLGELLAQNGEDRPAL
ERDASTMALSTYFALHHAWCVRTHEVRANRDAVETVARLLA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatgtcggctcggctaccaactcgcatcccgcccgcaccctcgtcatgggggtc
gtcaacgtcactcctaactcgttctctgacggaggcatgtgggccgatcctgaggtggcc
atccgccacgctcgcgacctcgttgtcgaaggagctgacatcatcgacgtcggtggtgaa
tcgacccgtccgggcaccgaacgcacccccgagcacgaagaattgcgccgcgtcctgccc
gtcgtcaaagctttggtggccgacggggtagccgtctccgtcgacactatgcgcgcctca
gtggccaaggctgttgtcgaggcaggagccaccatcgtcaacgacgtctctgggggcaag
gctgaaccggaaatccttgatgtcgttgccgacgctggcgtcgattacgttctcatgcac
tggcgcggtcaatccgccactatgcagaaccttgtcgactatgacgacgtggtagccgac
gtcatttctgagacctcccagcaggtcgacgcagctattgccgctggaatcgaccgtagg
cgcatcatcgtcgacccgggcattggtttctccaagacttccgagcacaactggcagctc
atgaacgccgttgacgccttccaagaaggatttgccgaccttcgtgtcctgtggggagtt
agtcgcaagcgcttccttggtgaacttctcgcccagaacggggaggaccgtccggccctc
gaacgcgatgcgagcaccatggccctgtcgacttatttcgcccttcatcacgcctggtgt
gtgcgcacccacgaagttcgggccaaccgcgacgccgtggagaccgttgcccgccttctc
gcctga

DBGET integrated database retrieval system