KEGG   Cutibacterium acnes TypeIA2 P.acn33: TIA2EST2_01460Help
Entry
TIA2EST2_01460    CDS       T01656                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
paz  Cutibacterium acnes TypeIA2 P.acn33
Pathway
paz00860  Porphyrin and chlorophyll metabolism
paz01100  Metabolic pathways
paz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TIA2EST2_01460
Enzymes [BR:paz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     TIA2EST2_01460
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     TIA2EST2_01460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_binding_2 FAD_oxidored DAO GIDA Pyr_redox_2 HI0933_like Thi4 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEW78399
Position
complement(341089..342519)
Genome map
AA seq 476 aa AA seqDB search
MNISDPQHVDAVVIGGGMAGLVAAWQFTQEGLHPVLVESRGYTGGLIARSTLAGISYDIG
AEGWAVRLPDTAELATELGLTVEKPTIAPSWVYFDDACFAMPDNAILGIPANLSDPAVII
ALGAEEAARAAELDRAPMPEDLPRDLGTLVASRMGSEVLRRLVTPIAGGIHAADPHLLSV
DVVSPGLRAATQATGSLAAGVALCRSRMPAGPAVASVAGGMFIMPAELRRQAEQAGATTM
TRVGARGLTRHGDQWLVETAGTSRNPDPSLPPVTDGEIRSFLTPRVVVACSAGPATKLLS
NVIDTVGPELAPGAPIGHVNLALQAPALDSSPRGNGMLVAPGTTTVTAKALTHMSAKWPS
LRESCPEGLHLLRVSYGRSGEANVALSVDQALTDASVLLGVDLSAEQVVDSQIIHWTGSL
APTTPQARAWRDGLHRQLEVLNQSGQGRIGLVGSWASGSGIAALVPQARRTVRQLV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaacatttctgatccgcagcacgtcgacgccgtcgtcattggcgggggcatggctggc
ctcgtggccgcctggcagttcacccaggaaggtctgcacccggtacttgtcgaatcccgc
gggtacaccggcgggctgattgccaggtcgacgctggccggaatcagctacgacatcggg
gccgaggggtgggcggtccgtctaccagacaccgctgaactggccaccgagttgggattg
acggttgagaagccgaccatcgccccgtcttgggtgtacttcgatgacgcctgcttcgcg
atgcccgataatgccattcttggcatcccggcgaacttgtcggacccagccgtcatcatc
gccctgggagcggaagaggctgcccgcgccgccgaacttgatcgcgcacccatgcctgag
gatctccctcgcgacctgggtacgctcgttgcctcccggatggggtcagaggtattgcgg
cgtctcgtcaccccgatcgccgggggaatccacgccgccgacccacatctactgtcagtc
gacgtcgtctcccccggtctgagggccgccacccaggccaccggatcgctagcagcggga
gttgcgctgtgccgctcacggatgccagcggggcctgcagtcgcgtcggtagccggtggc
atgttcatcatgccggccgagctgcgtcgtcaggcagaacaggccggcgcgacgaccatg
acccgagtaggagctcgcgggctaacccgccacggagatcagtggctagtggagaccgct
ggtacctcccgcaatccggatccatctttgccccccgtcaccgacggcgagattcgttcc
ttcctgacccctcgggtcgtcgtggcctgttcggctggacctgccacaaaactgctcagc
aatgtcatcgacaccgttgggcccgagttggcaccgggcgcgccgatcggccacgtcaat
ctcgccttgcaggcacccgcgctggactcgagcccacgcggaaacggcatgctggtggcc
cccggaacgaccaccgttactgccaaggcacttactcacatgtcggcgaagtggcccagc
ttgagagaatcgtgtcccgaaggtctccacttgctacgggtttcctatggtcgatctggt
gaagcgaatgtcgctttgagcgtcgatcaggctctaacggacgcttccgtcctactcggc
gtggacctctcggcggagcaggtcgtagactcccagatcattcactggacaggttccctc
gcaccgacgactccacaggcccgagcatggcgcgatggtctgcaccgccagctagaggta
ttgaaccagtctggacagggacggatcggcttagtggggtcgtgggcatcgggttcgggc
attgccgctctggtgccgcaggcccgccgaactgtccgtcaacttgtctga

DBGET integrated database retrieval system