KEGG   Cutibacterium acnes TypeIA2 P.acn33: TIA2EST2_01750Help
Entry
TIA2EST2_01750    CDS       T01656                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
paz  Cutibacterium acnes TypeIA2 P.acn33
Pathway
paz00010  Glycolysis / Gluconeogenesis
paz00260  Glycine, serine and threonine metabolism
paz00680  Methane metabolism
paz01100  Metabolic pathways
paz01110  Biosynthesis of secondary metabolites
paz01120  Microbial metabolism in diverse environments
paz01130  Biosynthesis of antibiotics
paz01200  Carbon metabolism
paz01230  Biosynthesis of amino acids
Module
paz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
paz_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:paz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIA2EST2_01750
  Energy metabolism
   00680 Methane metabolism
    TIA2EST2_01750
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TIA2EST2_01750
Enzymes [BR:paz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TIA2EST2_01750
Membrane trafficking [BR:paz04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    TIA2EST2_01750
Exosome [BR:paz04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TIA2EST2_01750
  Exosomal proteins of melanoma cells
   TIA2EST2_01750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEW78457
Position
complement(397627..398376)
Genome map
AA seq 249 aa AA seqDB search
MTAKLILLRHGESEWNSKNLFTGWVDVDLNEKGEGEARHAADLLKQENLLPDIVHTSLLR
RAIHTAYLALDGCDRHWIPVHRSWRLNERHYGALQGLNKAETKEKYGNDQFMAWRRSYDV
RPPDLDRDSEFSQFHDPRYADIPASERPVAECLKDVVARMVPYFTSDIAADLKDGKTVLV
AAHGNSLRALVKHLDEISDEDIAGLNIPTGIPLFYELDDNLKPVTRGGRYLDPEAAAAGA
KAVANQGNK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaagctcatcctgctccgccatggcgagagcgaatggaactccaagaacctc
ttcaccggctgggtggacgtcgatctcaacgagaagggcgagggcgaggctcgtcacgcc
gccgacctgctcaagcaggaaaacctcctgcccgatatcgtccacacctcgctgctacgt
cgtgctatccataccgcctacctagcccttgacggctgcgaccgccattggatcccggtg
catcgctcctggcgcctcaacgagcgtcactacggtgcgctgcagggtctcaacaaggct
gagaccaaggagaagtacggcaacgaccagttcatggcttggcgtcgctcctacgatgtt
cgtccaccggaccttgaccgcgacagcgaattcagccagttccatgacccgcggtacgcc
gacatcccggcgtccgagcgtccggtcgccgagtgtctcaaagacgtcgtggcccgcatg
gtgccgtacttcacctctgatattgctgccgaccttaaggacggcaagacggtgctcgtg
gctgctcacggtaactccctgcgcgccctcgtcaagcacctcgacgagatcagtgacgag
gacatcgccggcctcaacatcccgaccggtatcccgctgttctacgagcttgacgacaac
ctcaagcccgtgactagggggggccgctacctcgaccctgaggccgctgccgccggcgcc
aaggcagtcgctaaccagggaaacaagtaa

DBGET integrated database retrieval system