KEGG   Propionibacterium acnes TypeIA2 P.acn33: TIA2EST2_01915Help
Entry
TIA2EST2_01915    CDS       T01656                                 

Definition
ABC transporter permease
Orthology
K05846  
osmoprotectant transport system permease protein
Organism
paz  Propionibacterium acnes TypeIA2 P.acn33
Pathway
ABC transporters
Module
Osmoprotectant transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:paz02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(433206..433901)
Genome map
AA seq 231 aa AA seqDB search
MNHIAAALTWLTTSSHWAGSGSIGVRIGEHLWYTLLALTIAAITAIPAGLAIGHTGRGKT
IAVACSGALRALPSLGLLTLLAISTTIGIENPVVPSTIVLAILAIPPLLAGSYSGVDAID
DEVADGARACGMTEMQVLGRVELPLATPLLLGGLRSAALQVIATTTICSYLGMGGLGRFI
LDGLAVSDYPQMLAGSIVIIVLALVVDGLLCLVTRLLTGPGVRHALALTPQ
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacatcgcagcagctctcacttggttgacgacttcctcccactgggccggttcc
ggatctatcggggtccgcatcggcgagcacctttggtacaccttgctggcactcaccatc
gccgccatcaccgccattcctgctgggctagctatcggtcataccggtcgtggaaagact
atcgcagtggcttgttctggagctttgcgtgctctcccctctctcggcttgctcactctg
ctagcgatctcgacaacgatcggaatcgagaatcccgtcgtaccttccaccatcgtgcta
gctatcctggcgattccacccctgctggccggtagctattccggcgtagacgccattgac
gacgaggtagctgacggcgctcgagcctgcggcatgacagagatgcaggtactgggccgc
gtcgagttgccgctagccactcccctcctcttgggcgggttgaggtcggcggccttgcag
gtgatcgcgacgacgacaatatgttcatatttgggcatggggggtcttggccgtttcatc
cttgacgggctggcggtctccgactacccacagatgctcgccggatccatcgtcatcatc
gtgctggctctggttgttgacgggctgctctgcctcgttacccgcttactcactggcccg
ggtgtcagacacgccttggccctcaccccgcagtga

DBGET integrated database retrieval system