KEGG   Propionibacterium acnes TypeIA2 P.acn33: TIA2EST2_02990Help
Entry
TIA2EST2_02990    CDS       T01656                                 

Definition
L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
paz  Propionibacterium acnes TypeIA2 P.acn33
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:paz00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
654294..654869
Genome map
AA seq 191 aa AA seqDB search
MGVCADLTVTASWDCIAEILDLTPDIPHARGFNATERSGAVTVAAAMAAYTQLGILAFAI
YGHDVQNADDALTDDVSARILSFGRAALAVGLMRVRSYLAMGTVSMGIAGCHVPEQALQD
YLGMRSQYIDMVELGRRITAGIYDHVEWKWAMAWVSASVRTEIRLTSSTAMLTSVNSWSI
RSRWCWLPETS
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtctgtgcggatctcaccgtcaccgcctcgtgggactgcatcgccgaaatcctc
gacctgactccggacattccgcacgcgagggggttcaacgccactgaacgttctggagcc
gtcaccgtggctgcggccatggcggcctacacacagctgggtattctggccttcgccatc
tacggtcatgatgttcagaatgccgacgacgccctcactgacgacgtctcggcccggatt
ctcagcttcggacgagccgccctggcagtcgggctcatgagagtccggagctacttggcg
atgggcaccgtgtcgatgggcattgccggatgtcatgtccctgagcaggcccttcaggat
tacttgggcatgcgcagccagtacatcgacatggtggaactcggccgcaggatcaccgcg
ggtatctatgaccacgttgagtggaagtgggcgatggcatgggtctcagcatcggtgagg
accgaaatccggctgacaagcagcacagcgatgctgacaagcgtgaacagctggagtatt
cggtcaagatggtgctggttgcccgagacctcatga

DBGET integrated database retrieval system