KEGG   Propionibacterium acnes TypeIA2 P.acn33: TIA2EST2_03130Help
Entry
TIA2EST2_03130    CDS       T01656                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
paz  Propionibacterium acnes TypeIA2 P.acn33
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:paz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TIA2EST2_03130
  Amino acid metabolism
   00300 Lysine biosynthesis
    TIA2EST2_03130
Enzymes [BR:paz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     TIA2EST2_03130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
683771..684850
Genome map
AA seq 359 aa AA seqDB search
MDLKPTGDLHELFRRLVDIESVSMHEAPIADAVEETLAPHRHLEVTRLGNSVIARTHLGR
SERVVIAGHLDTVPVVENLPSYIEQRSDGDYLVGRGTCDMKGGIAVALALAVSLENPVRD
VTWAFYECEEIAAEHNGLEKIASWRPDLIDGDFAILMEPTDGRVEGGCQGTMRFTLEVPG
RAAHSARSWVGHNAIHDLSAVLERLNRWQERDPFVEVDGLTFREGLNATMLDAGVAGNVI
PPTATIQINYRFAPDKTTEQARQYMEDLFHEWPMNVLDLSAPARPGLDRPLAKSFVAAVG
GEPGPKYGWTDVARFGQLGIPAVNFGPGNALCAHQVDECCRLGSLDECYRALHTWLASR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggacttgaagccgacgggcgacctgcacgagctctttcgtcgactcgtcgacatcgag
tcggtgtccatgcacgaggcgcctattgccgatgctgtggaggagacgttggcaccacat
cggcatcttgaggtgacgagactcggtaactctgtcattgcccgtactcaccttgggcgt
tcggaacgggtcgtcattgctggtcacctcgacaccgttccggtcgtcgagaacttgccg
tcctatattgagcagcggtcggacggggattacctcgtgggtaggggcacgtgcgacatg
aagggcggtatcgccgtcgcgctcgccttggctgtgagccttgagaatccggtgagggat
gtcacttgggcgttctatgagtgtgaggagatcgcggccgagcacaacggtctggagaag
attgcctcttggcgccctgacctcatcgacggtgacttcgccatcctcatggaacccacc
gatggccgggtggagggtggttgtcagggaaccatgcgtttcacccttgaggtgccgggg
cgggcggcccattcagctcgttcgtgggtcgggcacaatgcgatccatgatctgtccgcc
gttttggagcgtctcaaccgctggcaagaacgggacccgtttgttgaggttgacgggctg
accttccgtgagggcctcaatgcgacgatgctcgacgccggtgtggccggtaacgttatt
ccccccaccgctactattcagattaattatcggttcgcccccgacaagacgaccgaacag
gctcggcagtacatggaggatctcttccatgagtggccgatgaacgttcttgacctgtcg
gctcccgccagaccagggctcgatcgtccgttggcgaagtctttcgttgctgcggtgggc
ggggaaccgggtcctaagtacgggtggaccgacgttgcccgtttcgggcaactcggaata
ccggctgttaacttcgggccggggaatgcgctgtgcgctcatcaggtggatgagtgttgt
cgtcttggctcactggatgagtgctaccgggcgctgcacacgtggttagcgtcgcgatga

DBGET integrated database retrieval system