KEGG   Propionibacterium acnes TypeIA2 P.acn33: TIA2EST2_03905Help
Entry
TIA2EST2_03905    CDS       T01656                                 

Definition
ATPase family associated with various cellular activities (AAA)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
paz  Propionibacterium acnes TypeIA2 P.acn33
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:paz00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(849207..851009)
Genome map
AA seq 600 aa AA seqDB search
MPRHFPFVAIVGQSEPRLALTLLAIDPMIGGVLITGPLGTAKSTCARSFVDLVPGIVVRD
VTAGTTVDRLIGSMDLEAALASGRRRDHVGLLTEAQALCADDVNLFDDAVTAALIGRPED
LPLIATMAVGADTVHPQLLDRFGLCAVTVPCRNPKDRELIVNHRLTFDDGPDSFITTCTD
ATNEVVNRICAARNKLPDLEWTDAARNKFTELLTQAHAPGQRADLGLARSATAYAAWRGD
NNVVVEDVTAVAELVLRHRRRNLSSSQAPSPDLNDAHSHSGPSSPHDGNEQLDEKGHDDS
TAASPRVIAPEETFNVLTSTPAAYDRTQRRARGRRMVTRSADLRGHVISSQPTRQPVDLS
LPATLRAAAPHQRARRASGEGRDGLSVVVKRSDWRRKVRESRTSTLVVFIVDASGSMGAR
GRMAASKAAVIGLLQDAYVKRDRVAVITFSGNNAQVIVPATSSIERAQRLLTTMAVGGQT
PLASGLSCAGRLIETELRRDSTLRPVAIVVTDGGGNVGLDGRVDRTATNQASDVAQTLSD
DTRTSWIIVDTSVNRVHQRDCEALSGILHAPRMTIDDLQSGVFIPFIRSTSRALSYSQRD
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtcattttccctttgtagcgatcgtgggccagtctgaacccagattggccctc
acgctgctagccatcgatccaatgatcggtggggtcctcatcacaggccctctcggcacg
gccaaatcaacctgtgcgaggtccttcgttgacctcgttccagggatcgtcgtccgtgac
gtcacggcaggcactaccgtggaccgattgatcggcagcatggatctcgaggctgcatta
gccagcggacggcgccgtgatcatgtcggcctcctcaccgaagcccaggctctgtgcgcc
gacgatgttaacctctttgatgacgccgtaacagctgccctcattggtcggcccgaagac
ctacccctcatagcaacaatggccgtaggggcggacaccgtccatccccagctcctcgac
cgctttggtctgtgcgccgtgactgttccctgtcgtaacccaaaggaccgggagctcatt
gtcaatcatcgccttacgttcgacgatggcccagactccttcattactacatgcacagat
gccaccaatgaggtcgtgaaccgtatttgtgctgctcgaaacaaacttcctgacctggaa
tggaccgacgctgcacgaaacaagttcacagagctcttgacacaagcgcatgctcccgga
cagcgcgccgatcttggtttggctcgatcggcgactgcttacgcggcgtggcggggggac
aataatgtcgtcgtcgaagacgtcactgcggtggccgaactcgtcctgagacaccgccgg
cgaaacttgtcttcgtctcaggccccctcaccggatctcaatgatgctcactcccacagt
ggcccctcatcgccgcacgacggaaacgagcaactggatgaaaaaggccacgacgacagc
acggcagcttccccgagggtcatcgcccctgaggaaacctttaacgtactcacatccacc
cccgcagcatatgaccgaactcaacgtcgggcccggggacgccgaatggtcacccgatca
gcagatcttcggggccatgtgatcagctcacaaccgactaggcaaccggtcgatctgtca
ctgccggctaccctacgagcagctgcccctcaccaaagagcgcggcgtgcatcaggagag
ggacgtgatgggttgtccgtagtcgtcaaacgctctgactggagacgcaaggtgcgcgag
agtcggacgtcgactctcgtcgtattcatcgtcgacgcaagtggatccatgggtgcccgg
ggccgaatggcagccagcaaggcagcagtcatcggcctgctccaagatgcctacgtaaaa
cgtgatcgtgtcgccgtgatcacgttctctggcaataacgctcaagtgatcgtgcctgcg
acatcgagtatcgagcgtgcacagcggcttctgacgacgatggcagtcggcggacagacg
ccgctggcatcagggctctcatgcgctggaagactcatcgagacagagttgcgacgggat
tctacccttcgccccgtcgccatcgtggtgaccgatggtggcggtaacgttggacttgac
ggtcgggtggaccgaactgccaccaatcaggcatccgatgtcgcacaaactttgtccgac
gacacaagaacctcgtggatcatcgtagatacctccgtcaaccgagtccatcaaagggac
tgcgaagcactgtcaggaattcttcatgcgcctcgcatgaccatcgacgatctgcaatcc
ggagtcttcatccctttcattcgatccacgagtcgagccctttcttattctcagagagat
tga

DBGET integrated database retrieval system