KEGG   Propionibacterium acnes TypeIA2 P.acn33: TIA2EST2_03995Help
Entry
TIA2EST2_03995    CDS       T01656                                 

Definition
phosphoglycerate mutase family protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
paz  Propionibacterium acnes TypeIA2 P.acn33
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:paz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TIA2EST2_03995
   01230 Biosynthesis of amino acids
    TIA2EST2_03995
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIA2EST2_03995
  Energy metabolism
   00680 Methane metabolism
    TIA2EST2_03995
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TIA2EST2_03995
Enzymes [BR:paz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TIA2EST2_03995
Exosome [BR:paz04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TIA2EST2_03995
  Exosomal proteins of melanoma cells
   TIA2EST2_03995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(870549..871295)
Genome map
AA seq 248 aa AA seqDB search
MHLLLIRHGQSENNAFAAQSVETYQQGRKPDPELTELGRRQAQALGKWIGSVSPRPTKLY
ASPMMRTIQTADPVAEALDLPIIINDLIFERPGPVQIVDGVETGHPGSPRSALSAITDRA
VFPESITEEGWREARIETAAEAADRAGRIAKWIRDTHNDDECIAIVAHGAIGSMMLLHLI
APQLAAGLRNHSIGSEPHWIGLQNTATSMIELHPDGYEVHWINRVDHLIEAGMVHGAVAA
STGNPGTR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgcatcttctcctcatccgccacggccagtccgagaacaatgccttcgctgcgcagtct
gtcgagacttaccagcagggtcgcaagcctgacccggagctcaccgagcttggacgacgt
caagctcaggccctagggaagtggatcggatcggtctctcctcggccaacgaagctgtat
gcctcccccatgatgcgtaccatccagacggctgacccggtcgctgaggcccttgatctt
cctatcatcatcaatgacctcatcttcgagcgtccaggtccagttcagatcgttgacggc
gtcgaaaccggtcatccaggatcgccgcgatcagctttgtcggccatcacagaccgtgct
gttttccccgagtccatcaccgaggaagggtggcgcgaagctcgcatcgagaccgccgcc
gaggctgctgaccgcgccggcagaatcgccaagtggatccgcgatacccacaatgatgac
gagtgcatcgcgatcgtcgctcacggcgcgatcggatccatgatgttgctgcatctcatc
gccccacaacttgccgctggtctgcgaaaccactccatcggcagcgaaccgcactggatc
gggcttcagaacaccgccacctcgatgatcgagttgcacccggacgggtacgaagttcat
tggatcaatcgcgtggatcaccttatcgaagccggtatggttcacggcgccgtcgccgca
tccaccggcaaccccggtacccgctga

DBGET integrated database retrieval system