KEGG   Propionibacterium acnes TypeIA2 P.acn33: TIA2EST2_04035Help
Entry
TIA2EST2_04035    CDS       T01656                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
paz  Propionibacterium acnes TypeIA2 P.acn33
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:paz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TIA2EST2_04035 (tpiA)
   01230 Biosynthesis of amino acids
    TIA2EST2_04035 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIA2EST2_04035 (tpiA)
   00051 Fructose and mannose metabolism
    TIA2EST2_04035 (tpiA)
   00562 Inositol phosphate metabolism
    TIA2EST2_04035 (tpiA)
Enzymes [BR:paz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TIA2EST2_04035 (tpiA)
Exosome [BR:paz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TIA2EST2_04035 (tpiA)
  Exosomal proteins of bladder cancer cells
   TIA2EST2_04035 (tpiA)
  Exosomal proteins of melanoma cells
   TIA2EST2_04035 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
880808..881587
Genome map
AA seq 259 aa AA seqDB search
MSRTPIMAGNWKMNLDHVAATSLVQDLGEALKAAGYDSSKSEAVVIPPFTDIRPVAIIID
GDKLPIAYGAQDISAHDDGAYTGEVSGAMLSKLGCRYVVVGHSERREYHNESDELVNAKA
KKVIENGMTPIICCGEALEVRKAGKHVEHTVGQIKADLDGISAEQVAKLVIAYEPIWAIG
TGETATADDAQEVCQAIREAVKELYDAPTAEAVRIQYGGSVKPANVAEIMAKPDVDGALV
GGASLKAGDFSKIVTFYEA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtaccccgatcatggccggcaactggaagatgaacctcgaccacgttgctgct
acctccctcgtccaggatctcggtgaggccctcaaggccgcgggatacgactcctccaag
tcggaggccgtcgtcatcccgccgttcaccgatatccgtcctgttgccatcatcattgat
ggcgacaagttgccgatcgcctacggtgcccaggatatttcggctcacgacgatggcgct
tacaccggcgaggtgtccggcgccatgctgtcgaagctgggttgccgctatgtcgtcgtt
ggccactccgagcgtcgcgagtaccacaacgagtccgacgaactggtcaatgccaaggct
aagaaggtcatcgaaaatggaatgaccccaatcatctgctgtggcgaggccctcgaggtt
cgcaaggctggcaagcacgtcgaacataccgttggccagatcaaagccgaccttgacggc
atttctgccgagcaggtcgccaagcttgtcattgcctacgagcccatctgggccatcggc
actggcgagactgccaccgctgacgatgcccaggaggtctgccaggccatccgcgaggcc
gtcaaggagctttacgacgccccgaccgccgaggcggtgcgcattcagtacggtggttca
gttaaaccggccaacgtcgctgagatcatggccaagccagacgttgacggcgctctcgtt
ggcggagcctcgctcaaagctggcgatttctccaagattgtaactttctacgaggcctga

DBGET integrated database retrieval system