KEGG   Cutibacterium acnes TypeIA2 P.acn33: TIA2EST2_04035Help
Entry
TIA2EST2_04035    CDS       T01656                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
paz  Cutibacterium acnes TypeIA2 P.acn33
Pathway
paz00010  Glycolysis / Gluconeogenesis
paz00051  Fructose and mannose metabolism
paz00562  Inositol phosphate metabolism
paz01100  Metabolic pathways
paz01110  Biosynthesis of secondary metabolites
paz01120  Microbial metabolism in diverse environments
paz01130  Biosynthesis of antibiotics
paz01200  Carbon metabolism
paz01230  Biosynthesis of amino acids
Module
paz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
paz_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:paz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIA2EST2_04035 (tpiA)
   00051 Fructose and mannose metabolism
    TIA2EST2_04035 (tpiA)
   00562 Inositol phosphate metabolism
    TIA2EST2_04035 (tpiA)
Enzymes [BR:paz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TIA2EST2_04035 (tpiA)
Exosome [BR:paz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TIA2EST2_04035 (tpiA)
  Exosomal proteins of bladder cancer cells
   TIA2EST2_04035 (tpiA)
  Exosomal proteins of melanoma cells
   TIA2EST2_04035 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEW78902
Position
880808..881587
Genome map
AA seq 259 aa AA seqDB search
MSRTPIMAGNWKMNLDHVAATSLVQDLGEALKAAGYDSSKSEAVVIPPFTDIRPVAIIID
GDKLPIAYGAQDISAHDDGAYTGEVSGAMLSKLGCRYVVVGHSERREYHNESDELVNAKA
KKVIENGMTPIICCGEALEVRKAGKHVEHTVGQIKADLDGISAEQVAKLVIAYEPIWAIG
TGETATADDAQEVCQAIREAVKELYDAPTAEAVRIQYGGSVKPANVAEIMAKPDVDGALV
GGASLKAGDFSKIVTFYEA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtaccccgatcatggccggcaactggaagatgaacctcgaccacgttgctgct
acctccctcgtccaggatctcggtgaggccctcaaggccgcgggatacgactcctccaag
tcggaggccgtcgtcatcccgccgttcaccgatatccgtcctgttgccatcatcattgat
ggcgacaagttgccgatcgcctacggtgcccaggatatttcggctcacgacgatggcgct
tacaccggcgaggtgtccggcgccatgctgtcgaagctgggttgccgctatgtcgtcgtt
ggccactccgagcgtcgcgagtaccacaacgagtccgacgaactggtcaatgccaaggct
aagaaggtcatcgaaaatggaatgaccccaatcatctgctgtggcgaggccctcgaggtt
cgcaaggctggcaagcacgtcgaacataccgttggccagatcaaagccgaccttgacggc
atttctgccgagcaggtcgccaagcttgtcattgcctacgagcccatctgggccatcggc
actggcgagactgccaccgctgacgatgcccaggaggtctgccaggccatccgcgaggcc
gtcaaggagctttacgacgccccgaccgccgaggcggtgcgcattcagtacggtggttca
gttaaaccggccaacgtcgctgagatcatggccaagccagacgttgacggcgctctcgtt
ggcggagcctcgctcaaagctggcgatttctccaagattgtaactttctacgaggcctga

DBGET integrated database retrieval system