KEGG   Propionibacterium acnes TypeIA2 P.acn33: TIA2EST2_04110Help
Entry
TIA2EST2_04110    CDS       T01656                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
paz  Propionibacterium acnes TypeIA2 P.acn33
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:paz01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:paz00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
896148..897323
Genome map
AA seq 391 aa AA seqDB search
MTDQRGAICGAATLVVKVGSSSLTLPGGGIDVRRVDDLVDALSEVIAVGRRVVLVSSGAI
ATGFPAMGITHRPRTLAGKQAAASVGQGILLAHYASRFASHGLRVGQVLLTVNDLVRPTS
YRNAWSTLDTLLGLGVVPIVNENDTVATGEIRFGDNDRLAALVAELVRAQALILLSDVDA
LYTAHPDSPDARRVEVVEDIDTLDVDTHKAGSGVGTGGMTTKLEAARMATCAGVPVVLAA
AVDAPDVLAGAPVGTYFRPLATRRPRRLLWLADAATPQGQIVIDDGAVEALTQRHSSLLA
VGVTRVHGDFQAGDPVTILASDGRVVGRGIAQFSHDEVRVMRGRSSAWLAAEMGPAASRE
IIHRDAMVLSRRRKAEPSSRNQKSSGSRVTS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtgactgatcagcgtggagccatatgcggggccgccaccctggtggtcaaggtcggatct
tcctctttgactcttcctggtggcgggattgacgttcgtcgtgttgacgacctggttgat
gcgctgagtgaggtcatcgcggtcggccggcgtgtcgtcctggtgagttccggggcgatt
gccaccggatttcccgccatggggataactcatcgtccgcgcactttggctggcaagcaa
gcggccgcgtcggtgggacaaggtattttactggctcactacgcgtcgaggtttgccagt
cacgggttgcgggtggggcaggtactactcaccgtcaatgacctggtgcggcccacctcg
taccgcaatgcctggtcaaccctcgacactttgctggggttgggcgtcgtgccgatcgtc
aacgagaacgacacggtcgccaccggagaaattcggtttggcgataatgatcggcttgct
gccctggtagccgagctggtgcgcgctcaagccctcatcctgctctctgacgttgacgcc
ttgtacaccgcccatccggattcaccggatgctcgtcgcgtggaggttgtggaggacatc
gacacattggatgtcgatacccataaagctggttcgggggtgggaaccggcggcatgacc
acgaaacttgaagccgcccgaatggccacctgtgccggggtaccggtggtactcgcagcg
gcggtggatgccccggacgttctggctggtgcccccgtgggtacctacttccgcccgctg
gcgacgcgacggccccgacggttgctgtggttggccgacgctgccaccccgcagggacag
atcgtcatcgacgacggagctgtcgaagctttgacacagcgtcattcctcgttgttggcg
gtgggtgtgactcgggtacacggggatttccaagcaggcgacccagtgacgatcctggcc
tccgacggtcgagttgttggtcgcggtatcgcccagttctcccatgatgaggtgcgcgtc
atgaggggacgttcgagtgcctggctggccgcagaaatgggcccggcggcctctcgcgag
atcatccaccgcgatgccatggtgctgagtcgtcgtcgtaaagctgagccgtcgtcgagg
aaccagaaaagtagcgggtcaagggtgacgtcctga

DBGET integrated database retrieval system