KEGG   Cutibacterium acnes TypeIA2 P.acn33: TIA2EST2_04110Help
Entry
TIA2EST2_04110    CDS       T01656                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
paz  Cutibacterium acnes TypeIA2 P.acn33
Pathway
paz00330  Arginine and proline metabolism
paz00332  Carbapenem biosynthesis
paz01100  Metabolic pathways
paz01130  Biosynthesis of antibiotics
paz01230  Biosynthesis of amino acids
Module
paz_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:paz00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TIA2EST2_04110
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    TIA2EST2_04110
Enzymes [BR:paz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     TIA2EST2_04110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AEW78917
Position
896148..897323
Genome map
AA seq 391 aa AA seqDB search
MTDQRGAICGAATLVVKVGSSSLTLPGGGIDVRRVDDLVDALSEVIAVGRRVVLVSSGAI
ATGFPAMGITHRPRTLAGKQAAASVGQGILLAHYASRFASHGLRVGQVLLTVNDLVRPTS
YRNAWSTLDTLLGLGVVPIVNENDTVATGEIRFGDNDRLAALVAELVRAQALILLSDVDA
LYTAHPDSPDARRVEVVEDIDTLDVDTHKAGSGVGTGGMTTKLEAARMATCAGVPVVLAA
AVDAPDVLAGAPVGTYFRPLATRRPRRLLWLADAATPQGQIVIDDGAVEALTQRHSSLLA
VGVTRVHGDFQAGDPVTILASDGRVVGRGIAQFSHDEVRVMRGRSSAWLAAEMGPAASRE
IIHRDAMVLSRRRKAEPSSRNQKSSGSRVTS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtgactgatcagcgtggagccatatgcggggccgccaccctggtggtcaaggtcggatct
tcctctttgactcttcctggtggcgggattgacgttcgtcgtgttgacgacctggttgat
gcgctgagtgaggtcatcgcggtcggccggcgtgtcgtcctggtgagttccggggcgatt
gccaccggatttcccgccatggggataactcatcgtccgcgcactttggctggcaagcaa
gcggccgcgtcggtgggacaaggtattttactggctcactacgcgtcgaggtttgccagt
cacgggttgcgggtggggcaggtactactcaccgtcaatgacctggtgcggcccacctcg
taccgcaatgcctggtcaaccctcgacactttgctggggttgggcgtcgtgccgatcgtc
aacgagaacgacacggtcgccaccggagaaattcggtttggcgataatgatcggcttgct
gccctggtagccgagctggtgcgcgctcaagccctcatcctgctctctgacgttgacgcc
ttgtacaccgcccatccggattcaccggatgctcgtcgcgtggaggttgtggaggacatc
gacacattggatgtcgatacccataaagctggttcgggggtgggaaccggcggcatgacc
acgaaacttgaagccgcccgaatggccacctgtgccggggtaccggtggtactcgcagcg
gcggtggatgccccggacgttctggctggtgcccccgtgggtacctacttccgcccgctg
gcgacgcgacggccccgacggttgctgtggttggccgacgctgccaccccgcagggacag
atcgtcatcgacgacggagctgtcgaagctttgacacagcgtcattcctcgttgttggcg
gtgggtgtgactcgggtacacggggatttccaagcaggcgacccagtgacgatcctggcc
tccgacggtcgagttgttggtcgcggtatcgcccagttctcccatgatgaggtgcgcgtc
atgaggggacgttcgagtgcctggctggccgcagaaatgggcccggcggcctctcgcgag
atcatccaccgcgatgccatggtgctgagtcgtcgtcgtaaagctgagccgtcgtcgagg
aaccagaaaagtagcgggtcaagggtgacgtcctga

DBGET integrated database retrieval system