KEGG   Cutibacterium acnes TypeIA2 P.acn33: TIA2EST2_04450Help
Entry
TIA2EST2_04450    CDS       T01656                                 

Definition
(GenBank) putative Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
paz  Cutibacterium acnes TypeIA2 P.acn33
Pathway
paz00010  Glycolysis / Gluconeogenesis
paz00620  Pyruvate metabolism
paz00640  Propanoate metabolism
paz00680  Methane metabolism
paz01100  Metabolic pathways
paz01110  Biosynthesis of secondary metabolites
paz01120  Microbial metabolism in diverse environments
paz01130  Biosynthesis of antibiotics
paz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:paz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIA2EST2_04450
   00620 Pyruvate metabolism
    TIA2EST2_04450
   00640 Propanoate metabolism
    TIA2EST2_04450
  Energy metabolism
   00680 Methane metabolism
    TIA2EST2_04450
Enzymes [BR:paz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TIA2EST2_04450
Lipid biosynthesis proteins [BR:paz01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TIA2EST2_04450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEW78983
Position
957347..958129
Genome map
AA seq 260 aa AA seqDB search
MRKHDLSSLRVLGSVGESINPEAWRWFHDVVGDGTCPITDTWWQTETGMFQITTVPSMPL
KPGAVGRPVFGQEAAVVDEEGHELPAGKEGFLVLKNPWPAMMRTLYKDPDRYLEAYWTKY
PGVYLTGDSARIDDDGYIWIIGRADDVIKVSGHRIGTAEVESALIFHPAVAEAAAIGLPH
EVKRNAIHMVVVLNHSFEPTKNLVSDIRGHVAETLSPIAKPDTIEFVDKLPKTRSGKIVR
RVLKARVLGGDEGDLSTLED
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaaacacgatctgtccagtttgcgcgtactcggttcggttggcgagtccatcaac
ccggaggcttggcgctggttccacgacgtggtcggtgacggcacgtgtccgatcaccgat
acctggtggcagaccgaaactggcatgttccagatcaccactgtgccgtcgatgccgctc
aaaccaggtgccgttgggcgtccggtctttggccaggaggctgctgttgtcgacgaggag
ggccatgagctccctgcgggcaaagagggcttcctcgtcctcaaaaacccgtggccggcc
atgatgcgcaccctgtataaggatccggatcgatacctcgaggcgtactggacgaagtac
ccgggtgtctatctcaccggtgattccgcacgaatcgatgatgacggctacatatggatc
atcggacgtgctgacgacgtcatcaaggtatccggtcaccgcatcggtactgctgaggtg
gagtccgctctgatctttcaccccgccgtcgccgaggctgcggccatagggctgcctcac
gaagtgaagcgcaacgcgatccatatggtcgttgtactcaatcatagtttcgagccgacg
aagaatctcgtctctgatatccgcggacacgtcgccgaaaccctctcgccgattgccaag
cctgacaccatcgagttcgtcgacaagttgccgaagacccgctccggcaagatcgtgcgt
cgcgtcctcaaagctcgtgtcctgggtggagacgagggagacctgtcaaccctagaggac
tga

DBGET integrated database retrieval system