KEGG   Propionibacterium acnes TypeIA2 P.acn33: TIA2EST2_05600Help
Entry
TIA2EST2_05600    CDS       T01656                                 

Definition
glycosyl hydrolase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
paz  Propionibacterium acnes TypeIA2 P.acn33
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:paz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIA2EST2_05600
Enzymes [BR:paz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     TIA2EST2_05600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1211722..1213152
Genome map
AA seq 476 aa AA seqDB search
MKRILWGGATAASQYEGGFYDGKGMDTQDCRRWIPRLSNDTIQTRLLTEADIRNAKNSRS
DDCRFPFRMGSRGYEYWESDLHYITSLGLDVYRLSISWARLFPTGFEDQPNPEGVMYYDR
IIRTLAHAGIKVFITINHYAMPIAIVDKYGGWRHRDVIDLYLKMAKFVVDRWQENVDYWL
PVNEINSGYFSPYNGLGIIGTIDYSYDYRSVFNGLHYQMIASALITKYGRDIGARGKFVC
MVSCFDYYALHPTPEDNMKLVHDEQINQWWCADVLATGEYGYYTEKFLADHGVVLDITDK
DRGILRSNTCDIVSFSYYSSSICSVDEKREQVPGNLVPTLRNPSLEATEWGWQIDPMGLR
ITAHKVYDRYRKPIMVAENGLGARDNVDSDGRIHDNYRISYLERHMEQAELAVREGVDIE
AYFVWGIIDIVSAGSCEMEKRYGVVYVDADNEGRGTYKRLPKDSFYWYRDFIASHR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcattctgtggggtggggctaccgcggccagtcaatatgaaggcgggttctac
gacggaaagggaatggacacccaagactgtcgtcgatggattccgcggctatcgaatgat
acgatacaaactcgtctcctcaccgaggctgatattcgaaacgcaaagaattctcgttct
gacgactgccggttcccgttccgtatgggatcgcggggttacgaatactgggaatcagac
ttacactacattaccagtcttggcctagatgtatatcgtctttcgattagctgggcccgt
ctatttcccactggtttcgaggaccagcccaatccggaaggggtgatgtactatgaccgg
attattcgcacccttgcacatgctggaattaaagtcttcatcacgatcaatcactatgcg
atgccgattgcgatcgttgacaagtacggaggttggcgacatcgtgacgtcatcgatctg
tatcttaagatggcgaaatttgtcgtcgatcgctggcaagaaaatgtagactattggctt
cctgtaaacgagattaattccgggtatttcagtccttataatggactcggaataatagga
accatcgattactcctatgattatcggtcagtctttaatggtcttcattaccaaatgata
gcaagcgccctcataacaaaatacggtcgcgatatcggagcacgaggaaagttcgtgtgc
atggtgagctgtttcgattactatgcgctccatcccacacctgaggacaacatgaagctc
gttcacgacgagcagatcaatcagtggtggtgtgcagatgtactagcaacaggtgaatac
gggtattacacagagaagttcttggccgaccatggggtagtactcgacatcacggacaag
gaccgtggcatactcaggtcgaatacctgtgacatcgtgtcattttcatactattcatcg
tcgatttgtagtgtagacgaaaaacgtgaacaagtccctggaaacctggtaccaacattg
agaaaccctagtttggaagctaccgagtggggatggcagatagaccccatgggtttgagg
attacggctcacaaggtttacgaccggtaccggaagcccataatggttgctgagaatgga
ttgggtgcgcgggataatgtcgactctgatgggcgtatccacgataattatagaatatca
tatctcgagcgccatatggaacaggctgagcttgccgtgcgggagggtgtagatatagaa
gcatatttcgtttggggcatcattgacatcgtcagtgccggtagttgcgaaatggagaaa
aggtacggtgtcgtctatgtcgacgcagacaacgaagggcggggaacttataaacggttg
ccgaaagatagtttctattggtatcgcgacttcatcgcctctcataggtga

DBGET integrated database retrieval system