KEGG   Propionibacterium acnes TypeIA2 P.acn33: TIA2EST2_05665Help
Entry
TIA2EST2_05665    CDS       T01656                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
paz  Propionibacterium acnes TypeIA2 P.acn33
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:paz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TIA2EST2_05665
Enzymes [BR:paz01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     TIA2EST2_05665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1226237..1226842
Genome map
AA seq 201 aa AA seqDB search
MISHFSGMVSAAGPTWVVLDNHGVGIKVLCPPATAASARINQDMSLHTSLVVREESLTLY
GFVEADDRDAFELVQTASGVGPKLAAAIMSVLDAAQLATAITEEDDATLCRVPGIGRKGA
AKMILELKDKVAALTPRGASVSGATHVVAPWREQVAEGLVGLGWSAKDAEKAVDKVAALK
EADPAMTIGNLMRAALRSLAR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgatttcccatttttccggcatggttagtgccgctggcccgacgtgggtcgtccttgac
aatcatggggttggtatcaaggtgctgtgccctcctgccacagctgcgagtgctcgcatc
aaccaagatatgtccctgcacacctccctggttgtgagagaggagtccctgactctttac
gggttcgtcgaagctgatgatcgcgatgcttttgagctggtgcaaaccgcgtcgggagtc
ggtcccaaattagctgcagcgattatgagtgtccttgatgctgctcagctagccacggcg
ataaccgaagaagatgacgcaactctatgccgcgttcccggaattggtcgcaagggtgcg
gcgaaaatgatcctggagctcaaggacaaggtcgcagcccttaccccacgtggagcttcg
gtgagcggagcgacccatgtggtcgcaccgtggcgggaacaggtggcggaagggctggtc
ggcttgggctggtcggctaaagacgcggagaaggccgtcgacaaggtggctgctctcaag
gaagccgatccagctatgaccatcggcaacctcatgcgagcggcattgcgtagtttggcg
cggtga

DBGET integrated database retrieval system