KEGG   Propionibacterium acnes TypeIA2 P.acn33: TIA2EST2_07150Help
Entry
TIA2EST2_07150    CDS       T01656                                 

Definition
formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
paz  Propionibacterium acnes TypeIA2 P.acn33
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:paz03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1533933..1534703)
Genome map
AA seq 256 aa AA seqDB search
MPELPEVETVRAGLEQFVVPVVVDSVDVVDTRGLRPSGGLEDAALFETTLSGRQFTAVNR
RGKYLWFILDDGTAMLAHLGMSGQFRVSTQHAPQHRHTRIVITLDDGRDLRFLDQRTFGG
LTLAPLVDGIPGPVTHIAPDPFEECFDVDEVVRRLCARRSAIKRSLLDQTLVSGIGNIYA
DETLWRVRCHPETPCSRLSQSEAVELLQTACDVMAEAMSQGGTSFDSLYVNVNGESGWFS
RVLDAYGREDEPLPPM
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgagctccccgaggtcgagaccgttcgagccggactcgaacagttcgttgttccg
gttgtcgtcgacagcgtcgacgttgtcgatactcgcgggcttcgccccagcggtggactc
gaggacgctgcgcttttcgagacgaccttgtcgggtcgtcaatttactgccgtaaatcgc
cggggtaagtacctgtggttcatccttgacgatggcaccgcgatgttggctcatctaggt
atgagcggacaattccgtgttagcacccaacatgccccgcagcatcgccatacccgtata
gtcatcaccctcgacgatggtcgtgacctgcgcttcctcgaccagcgcaccttcggcgga
ttgaccctagccccgctcgttgatggtattcccggtccggtgacccacatcgcccctgat
ccgttcgaggagtgtttcgacgttgacgaggtagtgcgacggttgtgcgcacgcaggtcc
gccattaagaggagtttgctcgatcaaacccttgtttccgggattggcaatatctatgcc
gacgaaactctttggcgggtccgttgtcaccccgagacaccatgctctcgcctgagtcaa
tccgaagcggtggaattgttgcagacggcctgcgatgttatggcagaggccatgtctcag
ggcggtacctctttcgactctctttatgtcaacgtcaacggggaatcggggtggttttcc
cgtgttttggatgcctacggccgtgaggatgagcccctgccaccgatgtga

DBGET integrated database retrieval system