KEGG   Cutibacterium acnes TypeIA2 P.acn33: TIA2EST2_07485Help
Entry
TIA2EST2_07485    CDS       T01656                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
paz  Cutibacterium acnes TypeIA2 P.acn33
Pathway
paz00900  Terpenoid backbone biosynthesis
paz01100  Metabolic pathways
paz01110  Biosynthesis of secondary metabolites
paz01130  Biosynthesis of antibiotics
Module
paz_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:paz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TIA2EST2_07485
Enzymes [BR:paz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     TIA2EST2_07485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Semialdhyde_dh NAD_binding_3 Secretin
Motif
Other DBs
NCBI-ProteinID: AEW79582
Position
complement(1607523..1608746)
Genome map
AA seq 407 aa AA seqDB search
MKKVIILGSTGSIGTQTLEVISSRRDQFEVAGISAGGSDVGSLAQQIIDFSIPVVAVARE
DAAEELQRALAVQAGSRGRIVPNPRILTGPDASTELAAMPADVVCNAITGAAGLRPTLAT
LAAGTTLALANKESLVIGGRLVTQAAASGQIVPVDSEHSAFAQCLRGGGRNEVRRLVLTA
SGGPFRGRDRASLADVSAAEAMKHPTWNMGRVITINSSTLVNKGLELLEAALLYDVDLDD
ITVVVHPQSIVHSMVEFWDGATIAQASPPDMRLPIALGLSWPDRLPDAAAGCDWSTATQW
TFEPLDNDTFGAVELARRAGHAAGTAPAVFNAANESCVDAFCAGSIGFLDITDTIAAVLD
EHLSGDENDTLGARHVGDEALTLDAVLAADAWGRRRAAEVCARGIRR
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaggtcatcattctcggctccaccggatcgatcggaacccaaactctagaggtc
atttcgtcacgtcgtgaccagtttgaggtcgctggcatatcggcaggtggctcggatgtt
ggctcactagctcagcagataatcgacttctctatccccgtcgtagctgtcgctcgtgag
gatgccgctgaggagcttcagcgggctttggccgtgcaggctggatcacggggccgtatc
gtgcccaatcctcggatccttactggcccggatgcgtcgacagagctggcagctatgccc
gctgatgttgtctgtaatgccattaccggcgcggctggtttgcgaccgaccctcgccacc
ttggccgcagggaccactttggccttagcgaacaaggagtcgttggtcattggtggcagg
ctcgttactcaggcggccgcctcaggacagattgtccccgtggattctgagcactccgcc
ttcgcccagtgcctacgagggggcgggcgcaacgaggtgcgtcgccttgttctgaccgca
tccggcggacctttccgcggtcgcgaccgtgcctccctggccgatgtcagcgctgccgag
gccatgaagcatcccacctggaatatgggccgggtcatcaccattaactcgtcgactctg
gtgaataagggtttggagctgctcgaggcggccctactttatgatgttgatctcgacgac
atcaccgtcgtcgtccatcctcaatccatcgtccactcgatggtggagttctgggatggc
gccactattgctcaggcttcgcctcccgacatgagattgccgattgccttgggactgtct
tggccggatcgccttcctgacgcagctgccggctgcgactggtcgacggctactcagtgg
accttcgaaccccttgacaacgacactttcggggccgtcgaactagcccgacgcgctggt
catgctgcgggtactgcgccggccgtgttcaatgccgctaacgagtcctgtgtcgacgcc
ttctgtgccggaagtatcggtttcctcgacattaccgacaccattgccgcggtccttgac
gagcacctatccggtgacgagaacgacacccttggtgctcgacatgtcggtgacgaggcc
ctcaccctcgatgccgtgttggccgccgacgcctggggtcgtcgtcgcgccgccgaggtg
tgtgcccgggggattcgccggtga

DBGET integrated database retrieval system