KEGG   Cutibacterium acnes TypeIA2 P.acn33: TIA2EST2_08545Help
Entry
TIA2EST2_08545    CDS       T01656                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
paz  Cutibacterium acnes TypeIA2 P.acn33
Pathway
paz00020  Citrate cycle (TCA cycle)
paz00640  Propanoate metabolism
paz00660  C5-Branched dibasic acid metabolism
paz01100  Metabolic pathways
paz01110  Biosynthesis of secondary metabolites
paz01120  Microbial metabolism in diverse environments
paz01130  Biosynthesis of antibiotics
paz01200  Carbon metabolism
Module
paz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:paz00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TIA2EST2_08545 (sucC)
   00640 Propanoate metabolism
    TIA2EST2_08545 (sucC)
   00660 C5-Branched dibasic acid metabolism
    TIA2EST2_08545 (sucC)
Enzymes [BR:paz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     TIA2EST2_08545 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA GARS_A ATP-grasp SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: AEW79783
Position
complement(1859187..1860362)
Genome map
AA seq 391 aa AA seqDB search
MDLYEYQARDLFEKHGVPVLRGIVAETPEQASEAAAKLGTPVVAVKAQVKVGGRGKAGGV
KIAKSPAEAAERAEAILGMDIKGHTVHKVMVAEGADIAEEYYFSILLDRGERRYLAMCSR
EGGMDIETLAKERPEALAKVPVDPIDGVDDAKAREILSEAGFPDSEQDAIVPAVLKLWEI
YRDEDATLVEVNPMIKTGDGRILAIDGKMTVDNNASFRQPDHAGLVDRATTDPLELRAGE
LGLNYVKLDGNVGVIGNGAGLVMSTLDCVAYAGENFPGSPAPANFLDIGGGASAEIMANG
LDLIMSDEQVRSVFVNVFGGITACDQVALGIKGALEKLGDKAVKPLVVRLDGNAVAEGRK
ILEEFNHPLVTMVSTMDEAASKAAELASKEA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgtatgaataccaagcccgcgacctgtttgagaagcacggcgtgcccgtactt
cgaggcatcgtcgcggagactccagagcaggcgtccgaggctgcagcgaagctcggtacc
cccgtcgtcgccgtcaaggcgcaggtcaaagtgggtggccgtggcaaggctggcggtgta
aagatcgctaagtccccggccgaggcggctgaacgcgccgaggccatcctcggtatggac
atcaagggtcacaccgttcacaaggtgatggtcgctgaaggtgctgacattgccgaggaa
tactacttctcgatcttgctcgaccgtggagagcgtcgctaccttgcgatgtgctcgcgt
gagggtggcatggacatcgagacccttgctaaggagcgccccgaggctctcgccaaggtg
ccggtcgacccgattgacggcgttgacgatgctaaagcccgcgagatccttagcgaggca
gggttccccgactctgagcaggacgctatcgtcccggctgttctcaagctgtgggagatc
taccgtgacgaggatgccaccctcgtcgaagtcaacccgatgatcaagaccggcgatgga
cgcatcctggctatcgacggcaagatgactgttgacaacaacgcgtccttccgtcagcct
gaccatgccggcctggtggatcgcgccaccaccgacccgctcgagttgcgtgccggcgag
ctcggtctcaactacgtcaagctcgacggcaacgtcggcgtcatcggaaacggtgctgga
ctggttatgagcacccttgactgcgttgcttacgccggtgagaacttcccgggatctccg
gctcccgctaacttcctcgacatcggtggcggcgcctcggccgagatcatggccaacggc
cttgacctcatcatgagtgacgagcaggtgcgttccgtgttcgtcaacgtctttggcggt
atcaccgcctgtgaccaggtggcgcttggtatcaagggcgctctcgagaagttgggcgac
aaggccgtgaagccgctcgtcgtccgtctggacggcaacgctgtggccgagggccgcaag
attctcgaggaattcaaccacccgctcgtgaccatggtctcgaccatggacgaggccgcc
agcaaggccgccgagctcgcatccaaggaggcctga

DBGET integrated database retrieval system