KEGG   Cutibacterium acnes TypeIA2 P.acn33: TIA2EST2_09225Help
Entry
TIA2EST2_09225    CDS       T01656                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
paz  Cutibacterium acnes TypeIA2 P.acn33
Pathway
paz00071  Fatty acid degradation
paz00280  Valine, leucine and isoleucine degradation
paz00310  Lysine degradation
paz00360  Phenylalanine metabolism
paz00380  Tryptophan metabolism
paz00410  beta-Alanine metabolism
paz00640  Propanoate metabolism
paz00650  Butanoate metabolism
paz00903  Limonene and pinene degradation
paz01100  Metabolic pathways
paz01110  Biosynthesis of secondary metabolites
paz01120  Microbial metabolism in diverse environments
paz01130  Biosynthesis of antibiotics
paz01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:paz00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TIA2EST2_09225
   00650 Butanoate metabolism
    TIA2EST2_09225
  Lipid metabolism
   00071 Fatty acid degradation
    TIA2EST2_09225
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TIA2EST2_09225
   00310 Lysine degradation
    TIA2EST2_09225
   00360 Phenylalanine metabolism
    TIA2EST2_09225
   00380 Tryptophan metabolism
    TIA2EST2_09225
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TIA2EST2_09225
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TIA2EST2_09225
   00281 Geraniol degradation
    TIA2EST2_09225
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TIA2EST2_09225
   00627 Aminobenzoate degradation
    TIA2EST2_09225
   00930 Caprolactam degradation
    TIA2EST2_09225
Enzymes [BR:paz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     TIA2EST2_09225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1 Abhydrolase_6
Motif
Other DBs
NCBI-ProteinID: AEW79913
Position
complement(2001969..2002904)
Genome map
AA seq 311 aa AA seqDB search
MDEVKISGTDDVTIILDRPRAINSLSGEMLGAIGEAVKGSPRSIDLSGAGERGYCSGADI
RELRSLVLKDPEAAGDWLDGEYDVDAAIAEVHSGTAHLHGISMGGGLGLALRLKRVEARD
DLVLAMPETGIGLWPDVGACFELSRAPRLVGRHIAMTGAFIDAASALWAGLVDEVVDADG
EPVDVDPVACQLARDAVWIQECYDTDDPVEVCRRLADRPEPAARKTAEHIATRCPLSVAV
ALAAVVRAESASGLGEVLETDRALGRSFMRNSDFCEGVRAQLVDKDRNPHWSHESVADVP
ARQVEGMFDPS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggatgaggtgaagatcagcggtaccgacgatgtcacgatcatcttggaccgtccccga
gcgatcaactcgttatctggtgagatgctgggggctattggggaggccgtcaagggatcg
ccgcgcagcatcgatctatccggtgcgggagagcgcggctactgttcgggagctgacatt
cgcgagctcagatcgttggtattaaaggatcccgaggccgctggtgactggttggatggt
gagtacgacgttgacgctgccattgctgaggtgcattcggggaccgcgcatctgcatggc
atttccatgggcggcgggcttgggttggcactgcgccttaagcgggtcgaggctcgcgac
gacctcgtccttgcgatgccggaaacgggtattggtctatggcctgacgtgggtgcgtgt
ttcgagctctctcgggccccgcgccttgtcggccgccatatagccatgaccggggccttc
atcgatgcggcttcggcgctgtgggccggtttggtagatgaggtcgtcgacgccgacggc
gagcccgttgacgtcgatccggtcgcttgtcagttggcgcgcgatgcggtgtggattcag
gagtgttatgacactgatgatcccgtcgaggtgtgtcgtcgattggctgatcgtcccgag
ccggccgcgcgtaagacggctgagcacatcgcgacgcgctgtccgttgtcggtagctgtc
gcattggccgctgtcgtgagggctgaatccgcgtcaggtcttggcgaggtgttggagact
gatcgtgctctggggcggtcctttatgcgcaattcggacttttgtgagggggtgcgcgcc
cagctggtcgacaaggaccgcaacccgcattggtcccacgagagcgtggctgacgtgccc
gctcgtcaggttgaggggatgttcgacccgtcctga

DBGET integrated database retrieval system