KEGG   Propionibacterium acnes TypeIA2 P.acn33: TIA2EST2_10120Help
Entry
TIA2EST2_10120    CDS       T01656                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
paz  Propionibacterium acnes TypeIA2 P.acn33
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TIA2EST2_10120
Enzymes [BR:paz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     TIA2EST2_10120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2199628..2200998
Genome map
AA seq 456 aa AA seqDB search
MAVIGAGMTGLAAAHHLHSHGCRPVVLEAGQGVGGQVRSRRLGSDVVDMGPEAVPLRAPG
VAALVAELGLTDSMRHPVPGRVLLSSRRGVVEMPSGVTPVGPTKFLPTIASRILSPAGLL
RAGLEPFNAHPHLDDVSVGQFIAERFGDEVSRAVVDPLLGGIHAADLNTFSLAVAAPALE
QTVRNGDSIVAGTLKRNAAGRWSQLRHHSQRSGPRTPATATWKHGLMMLPEALARELTIH
TNTRARGIRQVGHEWVVDVTGPHGVGSVAVDDVIIATPARVAGALLATACPRASELLSQC
ESTTVATLVMQADLTDHPIATAQTWFIGSAWSALVRQVTNLSTTWHLAKPTFRIAMGRQR
GTPIDDLSDDDLVAMSVAELRRLGLALDPHDYVIERHRGAMPQPAPGHRERMAQLAATLN
GTGLHVGGAGIDGAGVGTAIAAGRRLARHITSKEEN
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtcatcggtgccggaatgacgggcctggcagccgcacaccacctacacagccac
ggctgtcgtcccgtcgtcctcgaagcggggcagggcgttggcggccaggtcaggtcccgt
cgtcttggttctgatgtggtcgacatgggacctgaagccgtgcctcttcgcgccccgggc
gtcgccgcactcgttgcggagctgggactaacggactccatgcgtcatcccgttcctggg
cgcgtcttattgtcgagccggcgtggagtcgtcgagatgccgtccggcgtaacaccagta
gggcccacgaagttcctccccactattgcctcgcgcatcctctcccctgccggactgtta
cgggccgggctcgaacctttcaacgctcacccgcaccttgacgacgtcagcgtcggccaa
ttcatcgccgaaagatttggtgacgaggtgagccgcgccgtcgtcgacccgctactgggg
ggtattcacgccgccgacctcaacacgttctcgctagcagttgccgcccccgctttggag
cagacggtcaggaacggcgactccatcgtcgccggaactctcaaacgcaatgctgccgga
cggtggtcgcagctccgccatcattcacagcgatccggtccgcgcacccccgccaccgcc
acctggaaacacggcctgatgatgttgccggaagcattggctagggagctcaccattcat
acgaatacccgtgccaggggaatccgtcaggtcggccacgaatgggtagtcgatgtcact
ggtccgcatggcgttggatcggttgctgttgatgacgtcatcattgccacccccgccagg
gttgcgggtgccctgcttgctaccgcatgcccgcgagcttccgagctgctgtcgcagtgt
gaaagcactaccgttgccacgctggttatgcaggctgaccttactgaccacccgatcgct
acggcccaaacgtggttcattggttcggcatggtctgccctggtgcgtcaggtgaccaat
ctctcgacgacgtggcacctcgccaaacccacctttcggatcgccatgggtcggcagcgt
ggaacccccatcgacgatctatctgacgacgacctcgtcgccatgagcgtggcagagttg
agacgtctcggactggctcttgacccccacgactacgtcattgagcgacaccgcggcgcc
atgccgcaaccagctcctggccaccgggagcgcatggcccagctcgccgcgaccctcaac
ggcaccggtctccatgtgggaggggccggtatcgacggtgccggagttggcaccgcaatt
gctgctggacgccgtctcgcacgccacatcacctcgaaggaggagaattag

DBGET integrated database retrieval system