KEGG   Propionibacterium acnes TypeIA2 P.acn33: TIA2EST2_11020Help
Entry
TIA2EST2_11020    CDS       T01656                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
paz  Propionibacterium acnes TypeIA2 P.acn33
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:paz01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:paz01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:paz00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:paz00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:paz00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:paz00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:paz00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2382379..2384625
Genome map
AA seq 748 aa AA seqDB search
MRLTPTLPDGHGLRIGILTSGGDAQGMNAAVRAVVRSALSVGAEVYAIYEGYQGMIDGGD
GIRRFGWDDVGSILNRGGTVIGTFRCKGMRERPGRLKAVRNLLEHGIDRLVVIGGDGSLT
GLDVLRTEWTDLVAELVDTGQVSAEVAREHPALMIAGLVGSIDNDLVGSDMTIGADTALH
RIVDAIDDLASTAASHQRSFVVEVMGRHCGYLALMAAVAGGADYVLIPERPPEDGWEDRM
CAELKRGRQAGRRDSIVVVAEGATDRSGNRISSEYVRQVLEDKLGEDARVTILGHVQRGG
RPSAYDRWASTWLGYHAVHEVLSTTPEAEGRVIGTGSNRIHRLPLVKAVADTKSVPGLIT
EGRYNEAMRMRGRSFVEMDAIFTELSEPARTTSDTAGDADRKRVAIMHAGGPAPGMNTAA
RAAVRLAISRGHTVVGIHNGFIGLATGDMSELAWSDVEGWAGEGGAELGTRREIPSTRDL
YAVSRALEDHHIDALLVIGGYSAYEGIYTMMTERDRYPAFRIPTVCIPASIDNNLPGSEL
SIGTDTALNVIVEAMDKIKESGIASRRCFVVETMGRDCGYLALMSGIAAGAERIYTNEDG
ISLDDLANDVHWLRESFAHGRRLFLAVRNENASHNYTTDFIARLLEEESHGMYDVRQVVL
GHMQQGGSPSPFDRLLANRLGYRALNLIDDELAAHQDGSWFIGVNESGMRPCSMDTMPSL
IDAAHRRPREQWWLQLRTIARMVSDEVR
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcacccccactctccccgacggtcatggtctgcgcattggcatcctgaccagc
ggtggcgacgctcagggcatgaacgctgctgtgcgggctgtggtgcgctctgcgctaagt
gtgggagccgaggtctatgcgatatacgagggctaccagggaatgatcgatggtggcgat
ggcatccgtaggttcgggtgggacgacgtcggctcgatcctcaaccgtggcggcaccgtg
atcggaaccttccgttgcaaggggatgcgcgaacgtccggggcgcctgaaggctgtcaga
aatctcctcgaacacgggatcgatcgtctcgtcgtcatcggcggtgacggttcgctcacc
ggcctggatgtgctgcgcaccgaatggacagacctggtcgctgaactcgtcgacaccggc
caggtgagcgccgaggtagcccgggaacaccccgccctcatgatcgccgggctcgtcgga
tccatcgacaatgacctcgtcggatccgatatgaccatcggtgccgatactgctctgcac
cgtattgtcgatgccatcgacgacctcgcctccaccgcggccagccaccagcgatccttc
gtcgttgaggtgatgggccgccactgcggctatctcgcccttatggcagcagttgccggc
ggagctgactatgttcttattccggaacggccgcccgaggacggttgggaggaccgcatg
tgcgccgagctcaaacgtggccgtcaggcgggccgacgtgactcgatcgtcgtcgtcgcg
gagggcgccaccgatcgttccgggaaccggatctcctcggagtacgtccgccaggtgctt
gaggacaaactcggtgaggacgcccgggttaccatcctgggccacgtccagcgcggcgga
cgaccgtcagcctatgaccgctgggcgtcgacctggttgggttatcacgcggttcacgag
gtgctctcgaccactccagaggccgaggggcgcgttatcggcactgggtccaaccgcata
catcgcctccccctggtcaaggccgtcgctgacacgaagtcggtgcccggtctcattacg
gagggccgttacaacgaggccatgcggatgaggggacgttcctttgtcgagatggacgcg
atcttcaccgaactcagtgaaccagctcgtaccacttccgacaccgctggtgacgccgac
cgcaagcgcgtcgcgatcatgcacgctggcggtccggccccgggcatgaatactgctgcc
cgtgctgcagtgcgactggcgatttcccgcggtcataccgttgtgggaatccataacggg
ttcatcggactagcgaccggggacatgtcggaattggcctggagcgacgtcgagggctgg
gccggggaaggcggcgctgagctgggtacccgccgcgagatccctagcactcgcgacctt
tatgctgtcagccgcgctctggaggatcatcacatcgacgcgttgctcgtcattggtggc
tactcggcctacgaaggtatctacaccatgatgactgagcgggaccggtacccggctttc
cgtattccgacggtgtgcattccggcttcgatcgacaacaacctccccggttcggaactg
tccatcggcaccgacaccgctctcaacgtcattgtcgaggcgatggacaagattaaagag
tcgggtatcgcgtccagacgctgcttcgtcgtcgagacgatgggtcgtgactgcggatac
ctcgcgctgatgtcgggtatcgcagctggcgctgagcggatctataccaacgaggacggc
atctccctggacgatctagccaacgacgtccattggttgcgggagtcattcgcccacgga
cgacgacttttccttgccgtgcgcaacgagaacgcatcgcacaattacaccaccgacttc
atcgcgcggctgctggaggaggaatcacacggcatgtatgacgtacgccaggtggtacta
gggcatatgcagcaaggcggctcaccctcacctttcgaccgcttgctcgccaaccgactc
gggtatcgcgctctcaatctcattgacgacgagttggcggcgcatcaggacggttcatgg
ttcattggcgtcaacgagtcgggcatgcggccctgttcgatggacaccatgccctctctc
attgacgccgctcatcgtcgtccccgcgaacagtggtggctgcaactgaggactattgcc
aggatggtctcggacgaggtgcggtaa

DBGET integrated database retrieval system