KEGG   Propionibacterium acnes TypeIA2 P.acn33: TIA2EST2_11020Help
Entry
TIA2EST2_11020    CDS       T01656                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
paz  Propionibacterium acnes TypeIA2 P.acn33
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:paz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TIA2EST2_11020
   01230 Biosynthesis of amino acids
    TIA2EST2_11020
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIA2EST2_11020
   00030 Pentose phosphate pathway
    TIA2EST2_11020
   00051 Fructose and mannose metabolism
    TIA2EST2_11020
   00052 Galactose metabolism
    TIA2EST2_11020
  Energy metabolism
   00680 Methane metabolism
    TIA2EST2_11020
Enzymes [BR:paz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TIA2EST2_11020
Protein phosphatases and associated proteins [BR:paz01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TIA2EST2_11020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2382379..2384625
Genome map
AA seq 748 aa AA seqDB search
MRLTPTLPDGHGLRIGILTSGGDAQGMNAAVRAVVRSALSVGAEVYAIYEGYQGMIDGGD
GIRRFGWDDVGSILNRGGTVIGTFRCKGMRERPGRLKAVRNLLEHGIDRLVVIGGDGSLT
GLDVLRTEWTDLVAELVDTGQVSAEVAREHPALMIAGLVGSIDNDLVGSDMTIGADTALH
RIVDAIDDLASTAASHQRSFVVEVMGRHCGYLALMAAVAGGADYVLIPERPPEDGWEDRM
CAELKRGRQAGRRDSIVVVAEGATDRSGNRISSEYVRQVLEDKLGEDARVTILGHVQRGG
RPSAYDRWASTWLGYHAVHEVLSTTPEAEGRVIGTGSNRIHRLPLVKAVADTKSVPGLIT
EGRYNEAMRMRGRSFVEMDAIFTELSEPARTTSDTAGDADRKRVAIMHAGGPAPGMNTAA
RAAVRLAISRGHTVVGIHNGFIGLATGDMSELAWSDVEGWAGEGGAELGTRREIPSTRDL
YAVSRALEDHHIDALLVIGGYSAYEGIYTMMTERDRYPAFRIPTVCIPASIDNNLPGSEL
SIGTDTALNVIVEAMDKIKESGIASRRCFVVETMGRDCGYLALMSGIAAGAERIYTNEDG
ISLDDLANDVHWLRESFAHGRRLFLAVRNENASHNYTTDFIARLLEEESHGMYDVRQVVL
GHMQQGGSPSPFDRLLANRLGYRALNLIDDELAAHQDGSWFIGVNESGMRPCSMDTMPSL
IDAAHRRPREQWWLQLRTIARMVSDEVR
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcacccccactctccccgacggtcatggtctgcgcattggcatcctgaccagc
ggtggcgacgctcagggcatgaacgctgctgtgcgggctgtggtgcgctctgcgctaagt
gtgggagccgaggtctatgcgatatacgagggctaccagggaatgatcgatggtggcgat
ggcatccgtaggttcgggtgggacgacgtcggctcgatcctcaaccgtggcggcaccgtg
atcggaaccttccgttgcaaggggatgcgcgaacgtccggggcgcctgaaggctgtcaga
aatctcctcgaacacgggatcgatcgtctcgtcgtcatcggcggtgacggttcgctcacc
ggcctggatgtgctgcgcaccgaatggacagacctggtcgctgaactcgtcgacaccggc
caggtgagcgccgaggtagcccgggaacaccccgccctcatgatcgccgggctcgtcgga
tccatcgacaatgacctcgtcggatccgatatgaccatcggtgccgatactgctctgcac
cgtattgtcgatgccatcgacgacctcgcctccaccgcggccagccaccagcgatccttc
gtcgttgaggtgatgggccgccactgcggctatctcgcccttatggcagcagttgccggc
ggagctgactatgttcttattccggaacggccgcccgaggacggttgggaggaccgcatg
tgcgccgagctcaaacgtggccgtcaggcgggccgacgtgactcgatcgtcgtcgtcgcg
gagggcgccaccgatcgttccgggaaccggatctcctcggagtacgtccgccaggtgctt
gaggacaaactcggtgaggacgcccgggttaccatcctgggccacgtccagcgcggcgga
cgaccgtcagcctatgaccgctgggcgtcgacctggttgggttatcacgcggttcacgag
gtgctctcgaccactccagaggccgaggggcgcgttatcggcactgggtccaaccgcata
catcgcctccccctggtcaaggccgtcgctgacacgaagtcggtgcccggtctcattacg
gagggccgttacaacgaggccatgcggatgaggggacgttcctttgtcgagatggacgcg
atcttcaccgaactcagtgaaccagctcgtaccacttccgacaccgctggtgacgccgac
cgcaagcgcgtcgcgatcatgcacgctggcggtccggccccgggcatgaatactgctgcc
cgtgctgcagtgcgactggcgatttcccgcggtcataccgttgtgggaatccataacggg
ttcatcggactagcgaccggggacatgtcggaattggcctggagcgacgtcgagggctgg
gccggggaaggcggcgctgagctgggtacccgccgcgagatccctagcactcgcgacctt
tatgctgtcagccgcgctctggaggatcatcacatcgacgcgttgctcgtcattggtggc
tactcggcctacgaaggtatctacaccatgatgactgagcgggaccggtacccggctttc
cgtattccgacggtgtgcattccggcttcgatcgacaacaacctccccggttcggaactg
tccatcggcaccgacaccgctctcaacgtcattgtcgaggcgatggacaagattaaagag
tcgggtatcgcgtccagacgctgcttcgtcgtcgagacgatgggtcgtgactgcggatac
ctcgcgctgatgtcgggtatcgcagctggcgctgagcggatctataccaacgaggacggc
atctccctggacgatctagccaacgacgtccattggttgcgggagtcattcgcccacgga
cgacgacttttccttgccgtgcgcaacgagaacgcatcgcacaattacaccaccgacttc
atcgcgcggctgctggaggaggaatcacacggcatgtatgacgtacgccaggtggtacta
gggcatatgcagcaaggcggctcaccctcacctttcgaccgcttgctcgccaaccgactc
gggtatcgcgctctcaatctcattgacgacgagttggcggcgcatcaggacggttcatgg
ttcattggcgtcaacgagtcgggcatgcggccctgttcgatggacaccatgccctctctc
attgacgccgctcatcgtcgtccccgcgaacagtggtggctgcaactgaggactattgcc
aggatggtctcggacgaggtgcggtaa

DBGET integrated database retrieval system