KEGG   Propionibacterium acnes TypeIA2 P.acn33: TIA2EST2_11215Help
Entry
TIA2EST2_11215    CDS       T01656                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
paz  Propionibacterium acnes TypeIA2 P.acn33
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:paz00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2431794..2433317)
Genome map
AA seq 507 aa AA seqDB search
MSDEKFVLAIDEGTTSARAIIFNHAGQIMAVGQQEFEQIFPRAGWVEHDPIEIWEAVRDV
VGLALTKANINRHQLAAAGITNQRETAVVWDKNTGEPVYNAIVWQDTRTQKICNELAGDK
GADRYKEICGLGLSTYFSGPKVKWILDNVEGARARAEAGDLLFGNMDTWVLWNLTGGING
GVHITDPTNASRTMLMDVRKLQWDDSMCEVMGIPKSMLPEIKSSSEIYGYGRKNGLLIDT
PISGILGDQQAATFGQACFQKGMAKNTYGTGCFMLMNTGEEAIFSENGLLTTVCYKIGDQ
PTVYALEGSIAVAGSLVQWLRDNLKMFETAPQIEALANTVEDNGGAYFVPAFSGLFAPYW
RPDARGALVGLTRYVNRGHIARAVLESTAFQTREVLEAMNADSGVPLTELRVDGGMTANE
TLMQFQADQVNVPVVRPVVAETTALGAAYAAGIAVGFWEGENDVTDNWAEDKRWEPKMDK
NERERLFRNWKKAVTKTFDWVDDDVKE
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgagaagtttgtactcgccattgacgagggcactacttccgcccgtgccatc
atctttaaccacgccggccagatcatggccgttggccagcaggagttcgagcagatcttc
ccgcgtgctggatgggttgagcatgacccgatcgagatctgggaggccgttcgcgacgtc
gttgggctcgccctgaccaaggccaacatcaaccgccaccagctggctgctgctggtatc
accaaccagcgcgagaccgcagtggtgtgggacaagaacaccggtgagccggtttataac
gccatcgtgtggcaggacacgcgcactcaaaagatctgtaacgaactagctggtgacaag
ggcgccgaccgctacaaggagatctgtggtctgggcctgtcgacctatttctctggcccg
aaggtcaaatggattctcgacaacgttgagggagcccgtgcgagggccgaggccggcgat
ctgctcttcggtaacatggacacttgggtgctgtggaacctgactggcggtattaacggt
ggcgtgcacatcaccgatccgaccaacgcgtcccgaaccatgctcatggacgtccgaaag
ctgcagtgggacgactcgatgtgcgaggtcatggggattccgaagtccatgcttcctgag
atcaagtcctcctccgagatctacggctatggtcgcaagaacggcctgctgatcgatacc
ccgatctccggcattcttggcgatcagcaggccgccacttttggccaggcttgcttccaa
aagggcatggcgaagaacacgtacggcaccggctgcttcatgctcatgaacacaggtgag
gaggccatcttctccgagaatggtctgctgaccaccgtctgctacaagatcggtgaccag
cccaccgtctatgccctggaaggttcgattgccgtcgctggatcgctggtacagtggctg
cgcgacaacctcaagatgttcgagaccgccccgcaaatcgaagctctcgctaacaccgtc
gaggacaatggtggcgcctactttgtgccggccttctctggcctgttcgcgccgtactgg
cgtccagacgcccgtggtgccctcgtgggcttgacccgctacgtcaaccgtggccacatt
gcccgcgccgtgctcgagtcaaccgccttccagactcgcgaggttcttgaggctatgaac
gccgactccggtgtgccgctgacggagctgcgcgtcgacggtggcatgaccgccaacgaa
accctcatgcagttccaggccgaccaggtcaatgtgccggtggttcgccccgtggtcgcc
gaaaccaccgctctgggcgccgcctacgccgctggcatcgctgtcggtttctgggaaggc
gagaatgacgtcaccgacaactgggccgaggacaagcgctgggaacccaagatggacaag
aatgagcgcgaacgtctgttccgcaactggaagaaggctgtcactaagaccttcgactgg
gtggacgacgacgtcaaggagtga

DBGET integrated database retrieval system