KEGG   Propionibacterium acnes TypeIA2 P.acn33: TIA2EST2_11395Help
Entry
TIA2EST2_11395    CDS       T01656                                 

Definition
ParB-like protein
Orthology
K03497  
chromosome partitioning protein, ParB family
Organism
paz  Propionibacterium acnes TypeIA2 P.acn33
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2477846..2478772)
Genome map
AA seq 308 aa AA seqDB search
MTVAAKHSGLGRGFGELFQRTDLDDDDEERVDDASTDGDAINERVGGSRLELISVDEISP
NARQPRKMFNEEELTELSESIRAVGVLQPVVVTPADNGYELVMGERRWRAARKAGLATVP
AIVRTTASEDMLRDALLENLHRVQLNPLEEAAAYEQMLNDFGCTQDELSEKIQRSRSQIA
NTIRLLKLSADVQKRLLDGEITAGHARCLLAIDNPEVQVGTANRVVDEGLSVRATEELVR
QTLDDTTEVKPHQRKKPGRDTEAVKLGEQLSQRFRTAVKVRRRNGRGTITFPFNDNEELE
RLIDIFSD
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgacagtggcagccaagcacagcggtttagggcggggtttcggagagttgtttcaacgc
acggatctcgatgatgatgacgaagagcgcgttgatgacgctagtactgacggcgacgcg
ataaacgaacgtgttggaggctctcggctcgagctcatctccgtggatgagatctctccg
aacgcgcgccaaccgcgtaaaatgtttaacgaggaagaactgaccgaactctctgagtct
atccgggcggtcggagttctgcagcctgtagttgtgaccccagccgacaacggctacgaa
ctcgttatgggtgagcgtcggtggcgtgctgctcgcaaggccggcctcgcaacggttcct
gcgatcgtgcgcaccacggcgagcgaggacatgctgcgagatgcgttacttgagaacctc
catcgcgtgcagttaaatcctcttgaagaagcagccgcttatgagcagatgctcaacgat
tttggatgcactcaggatgagctctctgagaagatccagcgttcccggtcacagattgcg
aacaccatccggttgctcaaacttagcgcggacgtgcagaaacgacttcttgatggtgag
atcaccgctggtcacgctagatgccttttggcgattgataatcctgaggtacaagtcggc
acagcgaatcgcgtcgtagacgaaggtttatctgtacgcgcgactgaagagctggttcgt
cagactttggacgatacgacagaggttaagccgcatcagcggaaaaaacccggtcgggat
actgaggccgtgaagctgggagaacagctatctcagcggttccgtaccgcagtcaaagtg
cggcgccgtaatgggagaggcaccataaccttcccattcaatgataatgaagagctagag
cgacttatcgacatattttctgactga

DBGET integrated database retrieval system