KEGG   Pseudomonas brassicacearum: PSEBR_a1021Help
Entry
PSEBR_a1021       CDS       T01472                                 

Definition
chemotaxis protein CheB
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
pba  Pseudomonas brassicacearum
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:pba00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSEBR_a1021
Enzymes [BR:pba01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PSEBR_a1021
Two-component system [BR:pba02022]
 CheA family
  WspE-WspRF
   PSEBR_a1021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1293745..1294755
Genome map
AA seq 336 aa AA seqDB search
MKIAIVNDMPLAVEALRRALAFEPAHQLVWVAVNGAEAVQRCAEYTPDLILMDLFMPIMD
GVEATRRIMADSPCAVVIVTGDSQQNVHRVFEAMGHGALDVVDTPALGVGNPADAAAPLL
RKITNIGWLIGERNKRERPVPTAQRAAVSRKSLVAIGSSAGGPAALEVLLKALPRNFAPA
IVLVQHVDEVFAAGMAEWLGSVSGHTVRLARHGETPQSGTVLLAGTNHHLRLLKDGTLAY
TAEPVNEIYRPSIDVFFESVAQYWSGDAVGVLLTGMGRDGAQGLKLMREQGYVTIAQDQR
SSAVYGMPKAAAAIDAAAHILALDAIAPRLLEIFTP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
ttgaagatcgccatcgtcaatgacatgcccctggcggtcgaagccctgcgccgcgccctg
gcgttcgagccggcgcatcaactggtctgggtggcggtcaatggggccgaggcggtgcag
cgctgcgccgaatacaccccggacctgatcctcatggacttgttcatgccgatcatggat
ggcgtggaggccacccgaaggatcatggccgacagtccctgcgctgttgtgatcgtcacc
ggtgacagccagcagaacgtccaccgggtgttcgaggccatgggccatggcgcgctggat
gtggtcgataccccggccctgggcgtcggtaacccggcagatgcggcggcgccgttgctg
cgcaagatcactaacatcggctggctgatcggtgagcgcaacaagcgtgaacgaccggtg
ccgacggcgcagcgtgcggcagtgtcgcgcaagagcctggtggccatcgggtcgtcggcg
ggcggtccggcggcgctggaggtgctgctcaaggcgctgccgcgtaactttgccccggcc
atcgtgctggtccagcatgtggacgaggtgtttgccgcgggcatggccgagtggctgggc
agtgtctcgggccacacggtgcgcctggcccggcacggcgagacgccgcagagcggcacg
gtgttgctggccgggaccaaccatcatctgcgtttgttgaaggacggtaccctggcctac
accgccgagccggtgaacgagatctaccggccctccatcgacgtgttttttgaaagtgtc
gcccagtactggagcggtgacgcggtgggcgtattgctcaccggcatgggtcgcgacggt
gcacaagggcttaagctcatgcgcgaacagggctatgtgaccatcgcccaggaccagcgc
agcagtgcggtgtacgggatgcccaaagcggcggccgccatcgacgccgccgcccatatt
ctcgccctggacgctatcgcgcctcggctgttggagatttttaccccatga

DBGET integrated database retrieval system