KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a1094Help
Entry
PSEBR_a1094       CDS       T01472                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Brite
Enzymes [BR:pba01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PSEBR_a1094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1373166..1373843
Genome map
AA seq 225 aa AA seqDB search
MAREQDDMLRRGIGMTSQRTRERLIQRLYEEGLSNAQVLEVIRRTPRHLFVDEALAHRAY
EDTALPIGHNQTISQPYMVARMSELLLEAGPLDKVMEIGTGSGYQTAVLSQLVERVFSVE
RIKVLQDRAKERLVELNLRNVVFRWGDGWEGWPALAPYNGIIVTAVATDVPQALLDQLAP
GGRLVIPVGAGEVQQLMLIVREEHGFSRHVLGAVRFVPLLNGPLA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtgagcaagacgatatgctgcgccgcggaatcggcatgacctcccagcgcacc
cgtgaacgactgatccagcgtctctacgaagaaggtctctccaacgcccaggtgttggaa
gtcattcgccgcacgccgcgccatctgttcgtcgatgaggccctggcccatcgcgcctat
gaagatacggcgttgccgatcggccacaaccagaccatttcccagccatacatggtggcc
cgcatgagcgagttgctgctggaggcgggaccgctggacaaggtgatggagatcggtacc
ggctcgggttaccagacggcggtgttgtcgcaactggtcgagcgggtgttttccgtagag
cggatcaaggtactgcaggatcgcgccaaggaacgcctggttgagttgaacctgcgcaac
gtggtgtttcgctggggcgatggctgggaggggtggccggccctggcgccgtacaacggc
atcatcgtgactgcggtggccaccgatgttccccaggctctgctggatcagcttgctccc
ggcgggcgactggtcattccggtgggtgccggtgaagtccagcaactgatgctgatcgtg
cgtgaagaacacggtttttcgcgacacgtcctgggggcggtgcggttcgtgcctttactc
aatgggccgttggcctga

DBGET integrated database retrieval system