KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a1209Help
Entry
PSEBR_a1209       CDS       T01472                                 

Definition
glucokinase: membrane protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSEBR_a1209
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSEBR_a1209
   00052 Galactose metabolism
    PSEBR_a1209
   00500 Starch and sucrose metabolism
    PSEBR_a1209
   00520 Amino sugar and nucleotide sugar metabolism
    PSEBR_a1209
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSEBR_a1209
   00524 Butirosin and neomycin biosynthesis
    PSEBR_a1209
Enzymes [BR:pba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PSEBR_a1209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1498913..1499863
Genome map
AA seq 316 aa AA seqDB search
MKLALVGDIGGTNARFALWKNHTLENIQVLATADYACPEDAIQVYLSGLGLKPGAIGSVC
LSVAGPVSGDEFRFTNNHWRLSNLAFCQTLQVEKLLLVNDFSAMALGMTCLRPDEYRVVC
EGTPEPLRPAVVIGPGTGLGVGTLLDLGEGRFAALPGEGGHVDLPMSSPRETQLWQHIYN
EIGHVSAETALSGSGLPRVYRAICAVDGHVPVLDTPESITAAGLAGDPIALEVLEQFCRW
LGRVAGNNVLTLGGRGGVYIVGGVVPRFADFFLESGFARCFADKGCMSDYFKGIPVWLVT
APYSGLMGAGVALEQS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactggctttggtcggtgatatcggtgggaccaacgcacgctttgcgctgtggaaa
aaccacaccctggaaaacatccaggtgctggcaacggcggattatgcctgcccggaagat
gccattcaggtgtacctcagtggcctgggcctgaagccgggcgccatcggttcggtgtgc
ctgtcggtggccggtcccgtgagcggcgatgagtttcgctttaccaacaatcactggcgc
ctgagcaacctggcgttctgccagaccttgcaggtggagaagctgttgctggtcaacgac
ttctcggccatggccctgggcatgacttgcttgcgtcccgatgagtaccgggtcgtgtgc
gaaggcaccccggagccgttgcgcccggcagtggtgatcggcccgggcaccgggctgggc
gtcggtacgctgctggacctgggcgagggtcgtttcgcggcgttgccgggggagggcggc
catgtcgacctgcccatgagcagcccgcgggaaacccagctgtggcagcacatctacaac
gaaatcggccacgtcagcgccgaaaccgccctgagtggcagcggcttgcctcgggtgtac
cgggccatttgcgcagtggacggccatgtgccggtgctcgacacccccgaatccatcact
gccgctggcctggctggcgacccgattgccctcgaagtgctcgagcagttctgccgctgg
ctggggcgcgtggccggcaacaatgtgttgacgctgggcgggcgtggcggtgtctatatc
gtcgggggcgtggtcccgcggtttgccgatttcttcctcgaaagtggtttcgcccgttgc
ttcgccgacaagggctgcatgagcgattacttcaagggcattccggtctggctggtgacc
gcgccgtactcgggcctgatgggcgcgggtgtggcgttggagcaaagttaa

DBGET integrated database retrieval system