KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a145Help
Entry
PSEBR_a145        CDS       T01472                                 

Definition
Tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSEBR_a145
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSEBR_a145
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSEBR_a145
Enzymes [BR:pba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PSEBR_a145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
167309..168541
Genome map
AA seq 410 aa AA seqDB search
MTQPTTPFNLRSGPDANGLFGAFGGRYVAETLMPLILDLAREYEVAKEDPAFLEELAYFQ
RDYVGRPSPLYFAERLTEYCGGAKIYLKREELNHTGAHKINNCIGQILLARRMGKKRIIA
ETGAGMHGVATATVAARFGLDCVIYMGTTDIERQQANVFRMKLLGAEVIPVVAGTGTLKD
AMNEALRDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKETREQLQAQEGRLPDSLV
ACIGGGSNAMGLFHPFLDDKSVEIIGVEAAGYGIETGKHAASLNGGVPGVLHGNRTFLLQ
DDDGQIIDAHSISAGLDYPGIGPEHAWLHDIGRVQYTSVTDAEALEAFHKCCRLEGIIPA
LESAHALAEVFKRAPNLPKDHLMVVNLSGRGDKDMQTVMHHMEQSQQEKH
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcctacgacccctttcaacctgcgcagcggtcccgatgccaacggcctgttc
ggtgcgttcggtggccgctatgtggccgaaaccctgatgccgctgatccttgatctggcc
cgcgaatacgaagtggcgaaggaagatccggcgttcctcgaagaattggcctacttccag
cgcgactacgtcggacgtccgagcccgctctacttcgccgagcgcctgaccgaatactgc
ggcggtgccaagatctatctcaagcgtgaggagctgaaccacaccggcgcgcacaagatc
aacaactgcatcggccagatcctgctggcgcggcgcatgggcaagaaacgcatcatcgcc
gagaccggcgccggcatgcacggtgtggccaccgccacggtggccgcgcgttttggcctc
gattgcgtgatctacatgggcaccaccgacatcgagcgccagcaggccaacgtgtttcgc
atgaagctgctgggcgctgaagtgatcccagtggtcgctggcaccggtaccctgaaagat
gcaatgaacgaggccctgcgcgactgggtcaccaacgtcgacagcacgttctacctgatc
ggtaccgtggctggcccgcatccgtatccggcgatggtgcgtgacttccaggctgtgatc
ggcaaggaaacccgcgagcagttgcaagcccaggaaggtcgcctgccggacagcctggtg
gcgtgcatcggcggtggctccaacgccatgggcctgttccacccgttcctggacgacaag
agcgtcgagatcatcggcgtcgaagccgccggttatggcatcgagaccggtaagcatgcg
gcgagcctgaacggcggcgtccccggtgtactgcacggcaaccgcaccttcctgttgcag
gacgacgatggtcagatcatcgacgcccattcgatttccgccggtctcgactaccccggc
atcggtccggaacacgcctggttgcacgacattggtcgcgtccagtacacctcggtgacc
gacgccgaagctctggaagcctttcacaaatgctgccgactggaagggatcattcctgca
ttggaaagcgcccatgccctggcggaagtgttcaaacgcgcaccgaacctgccgaaggat
cacctgatggtggtcaacctgtccggccgtggcgacaaagacatgcaaaccgtgatgcac
cacatggaacagtcccagcaggagaaacactga

DBGET integrated database retrieval system