KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a146Help
Entry
PSEBR_a146        CDS       T01472                                 

Definition
Tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSEBR_a146
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSEBR_a146
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSEBR_a146
Enzymes [BR:pba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PSEBR_a146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
168541..169353
Genome map
AA seq 270 aa AA seqDB search
MSRLQTRFAELKEQNRAALVTFVTAGDPDYDTSLAILKGLPAAGADVIELGMPFTDPMAD
GPAIQLANIRALGAQQNLAKTLQMVREFRKDNSETPLVLMGYFNPIHRYGVQRFIGEALE
SGVDGLIVVDMPPEHNSELCEPAQAAGLDFIRLTTPTTDDVRLPTVLNGSSGFVYYVSVA
GVTGAGAATLEHVEEAVARLRRHTDLPISIGFGIRTPEQAAAIARLADGVVVGSALIDHI
ANADTSEQAIDGVLSLCAALADGVRKARVS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcctgcaaacccgttttgccgaactcaaggaacagaaccgcgccgccctggtg
actttcgtcacggctggcgacccggactacgacacctcgctggcaatcctcaagggcctg
ccagcggccggtgccgatgtcatcgagctgggcatgccgttcaccgacccgatggccgac
ggtccggcgatccagttggcgaacattcgtgccttgggcgcccagcagaacctggcgaaa
accctgcagatggttcgtgagttccgcaaagacaacagcgagacgccgttggtgctgatg
ggctacttcaacccgatccaccgttatggcgtgcagcgtttcattggcgaggcgctggaa
tctggtgtggatggcctgatcgttgtggacatgccgcccgagcacaacagcgaactgtgc
gaaccggcccaggcagcaggcctggacttcatccgcctgaccacgccaaccaccgacgac
gtgcgtttgccaacggtgctcaatggtagttccggctttgtatattacgtatcggtggcg
ggtgtgaccggtgccggtgccgcgacgctggagcatgtggaagaagccgtggcgcgcttg
cgtcgccacaccgatttgccgatcagcattggtttcggtatccgtacgccggagcaggct
gcggccatcgcacgattggctgatggtgtggtggttggctcggcgctgatcgaccatatc
gccaatgccgatacgtcggaacaggcaatcgatggcgtgttgagcttgtgtgccgccctg
gccgatggtgtgcgcaaggcgcgtgtcagctga

DBGET integrated database retrieval system