KEGG   Pseudomonas brassicacearum: PSEBR_a146Help
Entry
PSEBR_a146        CDS       T01472                                 

Definition
Tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pba  Pseudomonas brassicacearum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSEBR_a146
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSEBR_a146
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSEBR_a146
Enzymes [BR:pba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PSEBR_a146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
168541..169353
Genome map
AA seq 270 aa AA seqDB search
MSRLQTRFAELKEQNRAALVTFVTAGDPDYDTSLAILKGLPAAGADVIELGMPFTDPMAD
GPAIQLANIRALGAQQNLAKTLQMVREFRKDNSETPLVLMGYFNPIHRYGVQRFIGEALE
SGVDGLIVVDMPPEHNSELCEPAQAAGLDFIRLTTPTTDDVRLPTVLNGSSGFVYYVSVA
GVTGAGAATLEHVEEAVARLRRHTDLPISIGFGIRTPEQAAAIARLADGVVVGSALIDHI
ANADTSEQAIDGVLSLCAALADGVRKARVS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcctgcaaacccgttttgccgaactcaaggaacagaaccgcgccgccctggtg
actttcgtcacggctggcgacccggactacgacacctcgctggcaatcctcaagggcctg
ccagcggccggtgccgatgtcatcgagctgggcatgccgttcaccgacccgatggccgac
ggtccggcgatccagttggcgaacattcgtgccttgggcgcccagcagaacctggcgaaa
accctgcagatggttcgtgagttccgcaaagacaacagcgagacgccgttggtgctgatg
ggctacttcaacccgatccaccgttatggcgtgcagcgtttcattggcgaggcgctggaa
tctggtgtggatggcctgatcgttgtggacatgccgcccgagcacaacagcgaactgtgc
gaaccggcccaggcagcaggcctggacttcatccgcctgaccacgccaaccaccgacgac
gtgcgtttgccaacggtgctcaatggtagttccggctttgtatattacgtatcggtggcg
ggtgtgaccggtgccggtgccgcgacgctggagcatgtggaagaagccgtggcgcgcttg
cgtcgccacaccgatttgccgatcagcattggtttcggtatccgtacgccggagcaggct
gcggccatcgcacgattggctgatggtgtggtggttggctcggcgctgatcgaccatatc
gccaatgccgatacgtcggaacaggcaatcgatggcgtgttgagcttgtgtgccgccctg
gccgatggtgtgcgcaaggcgcgtgtcagctga

DBGET integrated database retrieval system