KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a1502Help
Entry
PSEBR_a1502       CDS       T01472                                 

Definition
chemotaxis protein CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pba00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSEBR_a1502
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PSEBR_a1502
Enzymes [BR:pba01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PSEBR_a1502
Two-component system [BR:pba02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   PSEBR_a1502
Bacterial motility proteins [BR:pba02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PSEBR_a1502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1835154..1836287
Genome map
AA seq 377 aa AA seqDB search
MVVKVLVVDDSGFFRRRVSEILSADTSIQVVGTATNGKEAIDQALALKPDVITMDYEMPM
MDGITAVRHIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDFLPKNFEDISRNPDKVRQ
LLCEKVHSISRSNRRVGAYSAPAPAPVAAPSPAPTASSSFNPAPVRSASAPAPAPARPVP
ASASSPAPKRKAYKLVAIGTSTGGPVALQRVLTQLPANFPAPIVLIQHMPAAFTKAFAER
LDKLCNISVKEAEDGDILRPGLALLAPGGKQMMIDGRGAVKILPGDERLNYKPCVDITFG
SAAKSYGDKVLAVVLTGMGADGREGARLLKQGGSAIWAQDEASCVIYGMPMAIVKADLAD
AVYGLDDIGRHLVEACL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggtagttaaagtcctggtggtggacgattcggggtttttccgccgccgcgtctcggaa
attctttcggcggacacgagtattcaggtcgtcggtaccgcgaccaacggcaaagaggcg
atcgatcaggccctggcactcaagccggacgtgatcaccatggactacgagatgccgatg
atggatggcatcacggccgtgcggcatatcatgcagcgctgcccgaccccggtattgatg
ttctcgtccctgacccatgaaggcgcccgagtgaccctcgatgcgctggacgccggggcg
gtggatttcctgccgaaaaatttcgaagacatttcgcgcaaccccgacaaagtccggcag
ttgctgtgcgaaaaggtccacagcatttcccgcagcaatcgtcgtgtcggtgcctacagc
gcaccggcgccagcccctgttgcggcgccaagcccggcgccgactgcatcgagcagcttc
aatccggcaccggtacgcagtgcatcggcaccagcccctgcgccggctcgcccggtgccc
gccagtgcgtcgtcgccggcgcccaagcgcaaagcctacaagctggtcgctatcggcacg
tccacgggtggcccggtggcgctgcaacgggtcctgacccagttgccggccaacttcccg
gcccccatcgtgctgatccagcacatgccggcggcgttcaccaaggctttcgcggagcgc
ctggacaagctgtgcaacatcagcgtcaaggaagccgaggatggcgacatcctgcgtcca
ggcctggcgttgttggcgccaggtggcaagcagatgatgatcgatggccgcggcgcggtg
aaaatcctgccgggcgacgagcgtctgaactacaagccttgcgtggacattaccttcggt
tccgcggccaagtcctacggtgacaaagttctggcggtggtgctcaccggcatgggcgcc
gacggtcgcgaaggcgcgcgcctgctcaagcagggcggcagtgcgatctgggcccaggac
gaagccagctgcgtgatctacggcatgccaatggccatcgtaaaagccgatctcgccgac
gcagtgtacggattggacgacatcggtagacacctggtcgaggcctgcctgtaa

DBGET integrated database retrieval system