KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a1715Help
Entry
PSEBR_a1715       CDS       T01472                                 

Definition
Recombination protein
Orthology
K06187  
recombination protein RecR
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pba00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PSEBR_a1715
DNA repair and recombination proteins [BR:pba03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PSEBR_a1715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2101182..2101784
Genome map
AA seq 200 aa AA seqDB search
MSFSPLIRQLIDALRTLPGVGQKTAQRMALQLLERDRSGGSRLAQALSQAMEGVGHCRLC
RTLTEDDLCPQCADPRRDDSLLCVVEGPMDVYAVEQTGFRGRYFVLKGHLSPLDGLGPEA
IGIPQLIARIEEAGTFTEVILATNPTVEGEATAHYIAQLLNNKGLIASRIAHGVPLGGEL
ELVDGGTLAHSFAGRKPIAL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcagccctttgattcgccaactgatcgatgccctgcgaacgttgccgggtgta
ggtcagaaaactgcccagcgcatggcgttgcaattgctcgagcgtgatcgcagcggcggt
tcgcgcctggcccaggccctgagccaggccatggaaggcgtagggcattgccgtttgtgc
cgcaccctcaccgaagacgacctctgcccgcaatgtgccgacccgcgtcgggacgacagc
ctgctctgcgtggtggaagggccgatggatgtgtatgcggtagagcagaccggttttcgt
ggccgttatttcgtgctcaagggccatttgtcaccgctcgacggcttggggcctgaagcc
atcggcattccgcagttgatcgcgcggatcgaagaagcgggtacgttcacggaagtcatc
ctcgctacgaacccgacggtcgaaggcgaagccaccgcccattacatcgcccaactgctc
aacaacaaaggcctgatcgcctcgcgcatcgcccacggcgtgccgctgggtggggagctt
gagttggtggatggcgggacactggcgcattcgtttgcggggcgcaagccgatcgcgttg
taa

DBGET integrated database retrieval system