KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a1747Help
Entry
PSEBR_a1747       CDS       T01472                                 

Definition
multifunctional fatty acid oxidation complex
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSEBR_a1747
   01212 Fatty acid metabolism
    PSEBR_a1747
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSEBR_a1747
   00650 Butanoate metabolism
    PSEBR_a1747
  Lipid metabolism
   00071 Fatty acid degradation
    PSEBR_a1747
   01040 Biosynthesis of unsaturated fatty acids
    PSEBR_a1747
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSEBR_a1747
   00310 Lysine degradation
    PSEBR_a1747
   00380 Tryptophan metabolism
    PSEBR_a1747
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSEBR_a1747
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSEBR_a1747
   00281 Geraniol degradation
    PSEBR_a1747
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    PSEBR_a1747
Enzymes [BR:pba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PSEBR_a1747
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PSEBR_a1747
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PSEBR_a1747
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     PSEBR_a1747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2138032..2140179
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAITVKALESGIVELKFDLKGESVNKFNRLTLNELRQAVDTIKADASIKGVIVSS
GKDVFIVGADITEFVDNFKLPDAELIAGNLEANRIFSDFEDLNVPTVVAINGIALGGGLE
MCLAADYRVMSTTAKIGLPEVKLGIYPGFGGTVRLPRLIGADNAIEWIAAGKENRAEDAL
KVGAVDAVVEPGKLQEAALETIKRAISGEFDYKAKRQPKLEKLKLNAIEQMMAFETAKGF
VAGQAGPNYPAPVEAIKTIQKAANFGRDKALEVEAAGFVKLAKTSAAQSLIGLFLNDQEL
KKKAKAYDEIASDVKQAAVLGAGIMGGGIAYQSASKGTPILMKDINEHGIEQGLAEAAKL
LVGRVDKGRMTAAKMAEVLNGIRPTLSYGDFGHVDLVVEAVVENPKVKQAVLAEVEDKVK
EDTILASNTSTISISLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSEHAVATTVA
YAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKIMEKFGWPMGPAYL
MDVVGIDTGHHGRDVMAEGFPDRMKDDRRSAVDVLYEAKRLGQKNGKGFYAYETDKRGKQ
KKVADSSVLEVLKPIVYEQREVTDEDIINWMMIPLCLETVRCLEDGIVETAAEADMGLVY
GIGFPPFRGGALRYIDSIGVAEFVALADQYADLGALYHPTAKLREMAKNGQSFFG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaggctcttgaaagtggcatcgtcgaattg
aaattcgacctcaagggtgagtccgtcaacaagttcaaccgtctaaccctgaatgaattg
cgtcaggccgtggacactatcaaggcagatgcttcgatcaagggtgtgatcgtcagcagc
ggcaaggacgtgttcatcgtcggtgccgacatcaccgaattcgtcgacaacttcaagctg
cccgatgccgaactgatcgctggcaacctcgaagccaaccgtattttcagcgacttcgaa
gacctcaacgtaccgaccgtcgtggccatcaacggcatcgccctgggtggcggcctggaa
atgtgcctggcggcggattaccgcgtcatgtccaccacggccaagatcggcctgccggaa
gtcaagctgggcatctacccaggcttcggcggcaccgtgcgcctgccgcgcctgatcggt
gccgacaacgccatcgagtggattgccgccggcaaggaaaaccgtgctgaagacgcgctg
aaggtcggtgccgtggatgccgtggtcgaacctggcaagctccaggaagcggcccttgaa
accatcaagcgcgccatcagcggcgagttcgactacaaggccaagcgtcagccgaagctg
gaaaagctcaagctcaacgccatcgaacaaatgatggccttcgaaaccgccaagggtttc
gtggccggtcaggcaggcccgaactacccagcgccggtcgaagcgatcaagactatccag
aaagccgcgaacttcggtcgtgacaaggctctggaagtcgaagccgccggcttcgtcaag
ctggccaagacctcggctgcgcaaagcctgatcggtctgttcctcaatgaccaggaactg
aagaaaaaggccaaggcctacgacgaaatcgccagtgacgtgaagcaggccgccgtgctc
ggcgccggcatcatgggtggcggtatcgcctaccagtcggcgtccaaaggtacgccgatc
ctgatgaaggacatcaacgaacacgggatcgagcaaggcctggccgaagccgccaagctg
ctggtcggccgtgtcgacaaaggtcgcatgaccgctgcgaagatggccgaagtgctcaac
ggcattcgtccgaccctgtcctacggcgatttcggccatgtcgacctggtggtcgaagcc
gttgtcgagaacccgaaggtcaagcaggcggtactggctgaagtcgaagacaaggtcaaa
gaggacaccatcctggcctcgaacacctcgaccatctccatttcgctgctggccaaggcc
ctcaagcgtccggagaacttcgtcggcatgcacttcttcaacccggtgcacatgatgccg
ctggtggaagtgatccgtggcgagaagtccagcgaacacgccgttgctaccaccgtggcc
tacgccaagaaaatgggcaagaacccgatcgtcgtcaacgactgcccgggctttttggtc
aaccgcgtgctgttcccgtactttggcggtttcgccaagctggtcagcgccggtgtggac
ttcgtgcgcatcgacaagatcatggaaaaattcggctggccgatgggcccggcgtacctg
atggacgtggtcggcatcgacaccggccaccacggtcgcgacgtcatggccgaaggcttc
ccggaccgcatgaaggacgaccgtcgttcggccgtcgacgtgctctacgaagccaagcgc
ctgggccagaagaacggcaagggcttctacgcctatgagaccgacaagcgcggcaagcag
aagaaagttgccgactcgtcggttctggaagtgctcaagccgatcgtctacgagcagcgc
gaagtcaccgacgaggacatcatcaactggatgatgatcccgctgtgcctcgaaaccgtg
cgttgcctggaagacggcattgtcgaaaccgccgccgaagccgacatgggtctggtctac
ggtatcggtttccctccattccgtggcggtgcgctgcgctacatcgattcgatcggtgtc
gccgagttcgttgccctggctgaccagtacgctgatttgggcgcgctgtaccacccgacc
gcgaagctgcgtgaaatggccaagaacggccagagcttcttcggttaa

DBGET integrated database retrieval system