KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a175Help
Entry
PSEBR_a175        CDS       T01472                                 

Definition
4-aminobutyrate transaminase
Orthology
K14268  
5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PSEBR_a175
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSEBR_a175
   00310 Lysine degradation
    PSEBR_a175
Enzymes [BR:pba01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PSEBR_a175
    2.6.1.48  5-aminovalerate transaminase
     PSEBR_a175
Amino acid related enzymes [BR:pba01007]
 Aminotransferase (transaminase)
  Class III
   PSEBR_a175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
208953..210230
Genome map
AA seq 425 aa AA seqDB search
MSKTNADLMARRTAAVPRGVGQIHPIFAESAKNATVTDVEGREFIDFAGGIAVLNTGHVH
PKIIAAVTEQLNKLTHTCFQVLAYEPYVELCEKINAKVPGDFAKKTLLVTTGSEAVENAV
KIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALYPNELHGVS
IDDSIASIERIFKNDAEPRDIAAIIIEPVQGEGGFYVAPKEFMKRLRALCDQHGILLIAD
EVQTGAGRTGTFFAMEQMGVAADLTTFAKSIAGGFPLAGVCGKAEYMDAIAPGGLGGTYA
GSPIACAAALAVMDVFEEEHLLDRCKAVGERLVTGLKAIQKKYPVIGDVRALGAMIAVEL
FENGDSHKPNAAAVAQIVAKARDKGLILLSCGTYGNVLRVLVPLTAPDEQLDKGLAILEE
CFSEL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagactaacgctgacttgatggcccgccgtaccgccgctgttccacgcggtgtt
ggccagattcacccgatctttgccgaatcggcgaagaacgccacggtaaccgacgttgaa
ggtcgtgaattcatcgacttcgccggcggcatcgccgtgctgaacaccggccacgtacac
ccgaaaatcatcgccgccgtgaccgagcagctgaacaagctgacccacacctgcttccag
gtcctggcctacgagccctacgtggaactgtgcgaaaaaatcaacgccaaggtgccgggt
gatttcgccaagaaaaccctgctggtgaccaccggttcggaagcggtggaaaacgccgtg
aaaatcgcccgcgccgccacgggccgtgccggtgtgatcgccttcaccggcgcttaccac
ggtcgcaccatgatgaccttgggcctgaccggtaaagtcgtgccgtactcggccggcatg
ggtctgatgcccggcggcatcttccgcgcgctttacccgaacgaactgcacggcgtgagc
atcgacgactccatcgccagcatcgagcgtatcttcaagaacgacgccgagccgcgtgac
atcgcggcaatcatcatcgagccggtacagggcgaaggtggtttctacgtagcacccaag
gaattcatgaagcgcctgcgcgctttgtgcgaccagcacggcatcctgctgatcgctgac
gaagtgcagaccggtgccggccgtaccggcaccttcttcgccatggagcagatgggcgtt
gccgccgacctgaccaccttcgccaaatccatcgctggcggcttcccgttggccggtgtg
tgcggcaaggccgagtacatggatgcaatcgcgccgggtggcctgggtggcacctacgcc
ggtagcccgatcgcctgtgcggcggcgttggcggtaatggacgtgttcgaagaagaacac
ctgctggaccgctgcaaggcggtgggcgagcgtctggtgaccggcctcaaggcgatccag
aagaagtacccggtcatcggtgacgtgcgtgccctgggcgcgatgatcgccgtggagctg
ttcgaaaacggcgactcccacaagccgaacgcggcagcggtagcccaaatcgtggccaag
gcgcgcgacaagggcctgatcctgctgtcctgcggcacctacggcaacgtactgcgggtg
ctggtgccgctgaccgcgccggacgagcaactggacaaaggcctggcgatcctcgaagag
tgcttctccgaactctga

DBGET integrated database retrieval system