KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a175Help
Entry
PSEBR_a175        CDS       T01472                                 

Definition
(GenBank) 4-aminobutyrate transaminase (4-aminobutyrate aminotransferase)
  KO
K14268  5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba00250  Alanine, aspartate and glutamate metabolism
pba00310  Lysine degradation
pba00650  Butanoate metabolism
pba01100  Metabolic pathways
pba01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PSEBR_a175
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSEBR_a175
   00310 Lysine degradation
    PSEBR_a175
Enzymes [BR:pba01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PSEBR_a175
    2.6.1.48  5-aminovalerate transaminase
     PSEBR_a175
Amino acid related enzymes [BR:pba01007]
 Aminotransferase (transaminase)
  Class III
   PSEBR_a175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEA66308
UniProt: F2KD46
Position
208953..210230
Genome map
AA seq 425 aa AA seqDB search
MSKTNADLMARRTAAVPRGVGQIHPIFAESAKNATVTDVEGREFIDFAGGIAVLNTGHVH
PKIIAAVTEQLNKLTHTCFQVLAYEPYVELCEKINAKVPGDFAKKTLLVTTGSEAVENAV
KIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALYPNELHGVS
IDDSIASIERIFKNDAEPRDIAAIIIEPVQGEGGFYVAPKEFMKRLRALCDQHGILLIAD
EVQTGAGRTGTFFAMEQMGVAADLTTFAKSIAGGFPLAGVCGKAEYMDAIAPGGLGGTYA
GSPIACAAALAVMDVFEEEHLLDRCKAVGERLVTGLKAIQKKYPVIGDVRALGAMIAVEL
FENGDSHKPNAAAVAQIVAKARDKGLILLSCGTYGNVLRVLVPLTAPDEQLDKGLAILEE
CFSEL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagactaacgctgacttgatggcccgccgtaccgccgctgttccacgcggtgtt
ggccagattcacccgatctttgccgaatcggcgaagaacgccacggtaaccgacgttgaa
ggtcgtgaattcatcgacttcgccggcggcatcgccgtgctgaacaccggccacgtacac
ccgaaaatcatcgccgccgtgaccgagcagctgaacaagctgacccacacctgcttccag
gtcctggcctacgagccctacgtggaactgtgcgaaaaaatcaacgccaaggtgccgggt
gatttcgccaagaaaaccctgctggtgaccaccggttcggaagcggtggaaaacgccgtg
aaaatcgcccgcgccgccacgggccgtgccggtgtgatcgccttcaccggcgcttaccac
ggtcgcaccatgatgaccttgggcctgaccggtaaagtcgtgccgtactcggccggcatg
ggtctgatgcccggcggcatcttccgcgcgctttacccgaacgaactgcacggcgtgagc
atcgacgactccatcgccagcatcgagcgtatcttcaagaacgacgccgagccgcgtgac
atcgcggcaatcatcatcgagccggtacagggcgaaggtggtttctacgtagcacccaag
gaattcatgaagcgcctgcgcgctttgtgcgaccagcacggcatcctgctgatcgctgac
gaagtgcagaccggtgccggccgtaccggcaccttcttcgccatggagcagatgggcgtt
gccgccgacctgaccaccttcgccaaatccatcgctggcggcttcccgttggccggtgtg
tgcggcaaggccgagtacatggatgcaatcgcgccgggtggcctgggtggcacctacgcc
ggtagcccgatcgcctgtgcggcggcgttggcggtaatggacgtgttcgaagaagaacac
ctgctggaccgctgcaaggcggtgggcgagcgtctggtgaccggcctcaaggcgatccag
aagaagtacccggtcatcggtgacgtgcgtgccctgggcgcgatgatcgccgtggagctg
ttcgaaaacggcgactcccacaagccgaacgcggcagcggtagcccaaatcgtggccaag
gcgcgcgacaagggcctgatcctgctgtcctgcggcacctacggcaacgtactgcgggtg
ctggtgccgctgaccgcgccggacgagcaactggacaaaggcctggcgatcctcgaagag
tgcttctccgaactctga

DBGET integrated database retrieval system