KEGG   Pseudomonas brassicacearum: PSEBR_a1755Help
Entry
PSEBR_a1755       CDS       T01472                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pba  Pseudomonas brassicacearum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pba00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:pba00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2147843..2148853
Genome map
AA seq 336 aa AA seqDB search
MTAGLQGSLMVDVAGTWLTAEDRHLLRQPEVGGLIIFARNIEHPRQVRELSASIRAIRPD
LLLAVDQEGGRVQRLRQGFVRLPAMRAIADNPNAEYLAEQCGWIMATEVLAVGLDLSFAP
VLDLDYQRSAVVGSRSFEGDPERAALLAGAFIRGMNAAGMAATGKHFPGHGWAEADSHVA
IPNDERSLEQIRANDLVPFARLSKQLAAVMPAHVIYPQVDPNPAGFSRRWLQDILRGELQ
FDGVIFSDDLSMAGAHVVGDAASRIEAALTAGCDMGLVCNDRAAAELALSAAQRLKVKPS
ARIARMRGQACASTEYRQDPRWLAALGALRAAQLVD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgactgctggcctgcaaggctcgttgatggtggacgtcgccggtacctggctgacggcc
gaagatcgccacctgttgcgccagcctgaggtaggcgggctgatcatctttgcccgcaat
atcgagcatccacgtcaggtgcgtgagttgagcgcgtcgatccgcgccatccgccctgac
cttttattggcggtggatcaggaaggtggtcgtgtccagcggctgcgccagggttttgtg
cggttgccggcgatgcgggcgatagccgataacccgaacgccgagtacctcgccgagcag
tgcggctggatcatggccacagaagtgctggcggtcggtctcgacttgagctttgccccg
gtgctggacctcgattaccagcgcagcgccgtcgtcggcagtcgttctttcgagggtgac
cccgaacgcgctgcgttattggccggtgccttcatccgcggcatgaacgccgccgggatg
gccgccactggcaagcattttccggggcatggctgggccgaggccgattcccacgtggcg
attccgaacgatgagcgcagcctggagcagattcgcgccaacgacctggtgccgtttgcc
aggctgagcaaacaactggccgccgtcatgccggcccatgtcatctacccgcaggttgac
cccaatccagccgggttttcccgccgctggctgcaggacatcctgcgcggcgagttgcaa
ttcgatggcgtgatcttcagtgatgacctgtcgatggccggggctcatgtggtcggtgat
gctgccagtcgtatcgaggctgctttgacggcgggttgcgacatgggcttggtgtgcaat
gaccgtgctgccgcggagttggccttgagcgctgcccagcgcctgaaggtcaagccttcg
gcacggatcgcccgcatgcgcggccaggcctgtgcctccactgaataccgtcaggaccct
cgctggctggcggcgctcggcgcgctgagggctgcccagctggttgattga

DBGET integrated database retrieval system