KEGG   Pseudomonas brassicacearum: PSEBR_a1877Help
Entry
PSEBR_a1877       CDS       T01472                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pba  Pseudomonas brassicacearum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pba00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2290004..2290978
Genome map
AA seq 324 aa AA seqDB search
MSSQFPEARPRRLRRNASLRSLFQETEFTLNDLVLPIFVEEEIDDFVPIKSMPGVVRIPE
SKLAGEIERYARAGIKSVMTFGVSHHLDNDGSDTWSERGLVSRMAGICKDAVPEMIVMSD
TCFCEYTDHGHCGVLHGDEVDNDRTLVNLGKQAVAAARAGADVIAPSAAMDGQVQAIRRA
LDEAGFSQTAIMAYSTKFASALYGPFREAGGSALKGDRKSYQMNPMNRREALRESLLDEQ
EGADALMVKPAGAYLDIIRDIRQASNLPLSAYQVSGEYAMIKFAAQAGAIDEARVVRESL
GAIKRAGADLIFTYFAMDLALSGI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtccagccagttccccgaagcacgtccacgccgtctgcgtcgcaatgcaagcctgcgc
agcttgttccaggaaaccgagttcaccttgaacgacttggtgctgccgattttcgtcgaa
gaagaaatcgatgattttgtgccgatcaagagcatgcccggcgtggtgcgcattcctgaa
tcgaagctggccggcgagatcgagcgctatgcccgtgccggcatcaagtcggtgatgacc
tttggtgtgtcccatcacctggacaacgacggcagcgatacctggagcgagcgcggcctg
gtgtcgcgcatggccgggatctgcaaagacgcagtgccggagatgatcgtgatgtccgac
acctgcttctgtgaatacaccgatcatggtcactgcggtgtgctccacggcgatgaagtg
gacaacgaccggaccctggtcaacctgggcaagcaggccgtggcggcggcccgcgccggt
gccgatgtgatcgcgccatcggcggccatggacgggcaggtccaggcgattcgccgggcc
ctggatgaagccggcttcagccagacagcaatcatggcctattccaccaagttcgcctcg
gcactctatggcccgttccgcgaggccggcggcagcgcgttgaaaggcgaccgcaagagc
taccagatgaacccgatgaaccgccgcgaagcattgcgcgaatccttgctcgacgagcag
gagggtgccgatgcgctgatggtcaagccggccggtgcctacctcgatatcatccgcgac
attcgccaggcttcgaacctgccgttgtcggcttatcaggtcagtggcgaatacgcgatg
atcaagttcgccgcccaggctggtgccatcgacgaagcccgcgtggtacgcgagagcctt
ggcgccatcaagcgggcgggggcagacctgatcttcacctactttgccatggacctggcg
ctgagcgggatctga

DBGET integrated database retrieval system